Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.91
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
22886722 Hypoxia-induced down-regulation of XIAP mediates apoptosis in trophoblasts through interaction with increased IMUP-2; this mechanism underlies the pathogenesis of pre-eclampsia.
20432246 results suggest that IMUP-2 expression is specifically elevated in preterm pre-eclampsia and under hypoxic conditions, and that IMUP-2 induces apoptosis of the trophoblast
18507030 These findings demonstrate the up-regulation of imup-1 and imup-2 in human endometrial carcinomas and indicate that these molecules play a role in endometrial carcinogenesis in both Korean and Japanese patients.
17309599 Our findings suggest that the balance between hepsin and its inhibitor, HAI-2, may have prognostic value in RCC.
16189703 Nuclear translocation of H2RSP may be related to a signaling involved in the transition from cellular proliferation to differentiation in experimental murine colitis.
14981917 results showed the up-regulation of IMUP-1 and IMUP-2 in human ovarian epithelial tumors and suggested that the altered mRNA level of these molecules is possibly associated with ovarian tumorigenesis
11606055 H2RSP and H2RSP/HAI-2 chimeric peptides might function as a transcriptional regulatory peptide at the nucleus.

AA Sequence

MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSSSDSSSSSSDSDTDVKSHA      1 - 70
AGSKQHESIPGKAKKPKVKKKEKGKKEKGKKKEAPH                                       71 - 106
//

Text Mined References (15)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22886722 2013 Hypoxia-induced downregulation of XIAP in trophoblasts mediates apoptosis via interaction with IMUP-2: implications for placental development during pre-eclampsia.
20432246 2010 Increased immortalization-upregulated protein 2 (IMUP-2) by hypoxia induces apoptosis of the trophoblast and pre-eclampsia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18507030 Imup-1 and imup-2 overexpression in endometrial carcinoma in Korean and Japanese populations.
17309599 2007 Clinical relevance of hepsin and hepatocyte growth factor activator inhibitor type 2 expression in renal cell carcinoma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16809422 2007 Enhanced expression of hepatocyte growth factor activator inhibitor type 2-related small peptide at the invasive front of colon cancers.
16189703 2006 Nuclear translocation of H2RSP is impaired in regenerating intestinal epithelial cells of murine colitis model.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...