Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.06
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.093 0.000
group 3 medulloblastoma -1.200 0.002
lung carcinoma 1.600 0.000

Gene RIF (4)

PMID Text
26055238 Down regulated NRSN2 promotes cell proliferation and cell survival in hepatocellular liver cancer.
26045763 our findings suggest that NRSN2 promotes non-small cell lung cancer cell growth through PI3K/Akt/mTOR pathway
24019301 SOX12 and NRSN2 were identified as candidate genes that may be involved in the developmental defects in 20p13 microdeletion.
19824122 NRSN2 could be a tumor suppressor gene for hepatocellular carcinoma and a candidate biomarker for long-term survival in HCC

AA Sequence

MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGT      1 - 70
LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIG     71 - 140
WLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS          141 - 204
//

Text Mined References (16)

PMID Year Title
26055238 2015 Down-Regulated NRSN2 Promotes Cell Proliferation and Survival Through PI3K/Akt/mTOR Pathway in Hepatocellular Carcinoma.
26045763 2015 NRSN2 promotes non-small cell lung cancer cell growth through PI3K/Akt/mTOR pathway.
24019301 2013 SOX12 and NRSN2 are candidate genes for 20p13 subtelomeric deletions associated with developmental delay.
19824122 2009 Decreased expression of Neurensin-2 correlates with poor prognosis in hepatocellular carcinoma.
16527258 2006 Molecular characterization of a transport vesicle protein Neurensin-2, a homologue of Neurensin-1, expressed in neural cells.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...