Property Summary

NCBI Gene PubMed Count 55
Grant Count 36
R01 Count 21
Funding $1,731,354.79
PubMed Score 105.44
PubTator Score 60.84

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (41)

PMID Text
26362023 polymorphism of rs7950273 in the PDGFD gene is not associated with ischaemic stroke in the Chinese Han population
26157007 Novel findings reveal a new paradigm in matriptase activation involving PDGF-D-specific signal transduction leading to extracellular acidosis.
25760076 PDGF-D expression is associated with miR-106a and Twist1 in HCC patients
25391964 PDGFD-PDGFRbeta signalling is required for human neocortical development and local production of growth factors by radial glia supports the expanded germinal region and progenitor heterogeneity of species with large brains
25333347 PDGFD, CDH1 and SLIT2 are upregulated in low grade meningiomas and schwannomas compared with healthy tissue.
25332166 PDGF-D is highly expressed by ASCs, where it acts as a potent mitogenic factor.
24938433 PDGF-DD secreted by gastric cancer derived mesenchymal stem cells is capable of promoting gastric cancer cell progression in vitro and in vivo.
24870786 Compared with matched normal endometrial cases, PDGF-D was up-regulated in endometrial cancer. Expression of PDGF-D protein, found in 78% of the cases, was associated with nonendometrioid histologic type.
24646915 Data suggest that targeting platelet-derived growth factor-D as a strategy for endometrial cancer treatment.
24158561 PDGF-D is highly expressed in gemcitabine resistant (GR) liver neoplasm cells. Furthermore, down-regulation of PDGF-D in GR cells led to partial reversal of the EMT phenotype.
More...

AA Sequence

MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFP      1 - 70
NSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRI     71 - 140
KSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGVSYNSPSVTDPTLIADAL    141 - 210
DKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVN    211 - 280
IREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALV    281 - 350
DIQLDHHERCDCICSSRPPR                                                      351 - 370
//

Text Mined References (59)

PMID Year Title
26362023 2016 A study on the association of rs7950273 polymorphism in the PDGFD with ischaemic stroke in the Chinese Han population.
26157007 2016 Matriptase activation and shedding through PDGF-D-mediated extracellular acidosis.
25760076 2015 The PDGF-D/miR-106a/Twist1 pathway orchestrates epithelial-mesenchymal transition in gemcitabine resistance hepatoma cells.
25391964 2014 Radial glia require PDGFD-PDGFR? signalling in human but not mouse neocortex.
25343990 2015 Genome-wide association study of selenium concentrations.
25333347 2014 Global expression profile in low grade meningiomas and schwannomas shows upregulation of PDGFD, CDH1 and SLIT2 compared to their healthy tissue.
25332166 2015 Functional regulation of adipose-derived stem cells by PDGF-D.
24938433 2014 Gastric cancer-derived MSC-secreted PDGF-DD promotes gastric cancer progression.
24870786 2014 Overexpression of platelet-derived growth factor-D as a poor prognosticator in endometrial cancer.
24646915 2014 Over-expression of platelet-derived growth factor-D promotes tumor growth and invasion in endometrial cancer.
More...