Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 4.3e-06
COPD -1.100 3.2e-03
gastric carcinoma 1.100 4.4e-02
glioblastoma 1.500 2.0e-06
group 4 medulloblastoma -1.200 2.1e-05
medulloblastoma, large-cell 1.500 1.2e-04
osteosarcoma -2.296 1.5e-06
pediatric high grade glioma 1.200 1.2e-05
tuberculosis 1.200 1.6e-07

Gene RIF (2)

AA Sequence

MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKILHRYEITFTL      1 - 70
PPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEILLACEGGTGTCVRVTVQARV     71 - 140
MDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD                                        141 - 174
//

Text Mined References (14)

PMID Year Title