Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 1.55630922050018E-7
osteosarcoma 7933 1.5327835622927E-6
glioblastoma 5572 1.98950217287558E-6
atypical teratoid / rhabdoid tumor 4369 4.29686798044029E-6
pediatric high grade glioma 2712 1.1776494979242E-5
group 4 medulloblastoma 1875 2.06452699399305E-5
medulloblastoma, large-cell 6234 1.18464933128224E-4
COPD 116 0.00317488794846578
gastric carcinoma 832 0.0438064735538211

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.296 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.500 0.000
tuberculosis 1.200 0.000
pediatric high grade glioma 1.200 0.000
group 4 medulloblastoma -1.200 0.000
COPD -1.100 0.003
gastric carcinoma 1.100 0.044

Synonym

Accession Q9GZN8 A8K4J0 D3DVX8 Q5JX81 Q9NWX3
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKILHRYEITFTL      1 - 70
PPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEILLACEGGTGTCVRVTVQARV     71 - 140
MDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD                                        141 - 174
//

Text Mined References (12)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...