Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.17
PubTator Score 9.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.800 9.9e-06
astrocytic glioma -1.600 6.6e-03
Astrocytoma, Pilocytic -1.400 2.2e-08
atypical teratoid / rhabdoid tumor -1.900 4.9e-11
ductal carcinoma in situ 1.100 2.7e-03
ependymoma -2.000 1.4e-02
glioblastoma -1.700 1.8e-08
invasive ductal carcinoma 1.500 4.4e-03
medulloblastoma, large-cell -1.100 4.0e-03
oligodendroglioma -1.300 3.0e-02
osteosarcoma -2.267 1.6e-06
Pick disease -1.200 2.8e-04
primitive neuroectodermal tumor -1.100 4.1e-03
sonic hedgehog group medulloblastoma -1.700 1.5e-06
subependymal giant cell astrocytoma -2.539 3.6e-03
tuberculosis 1.800 1.2e-06

Gene RIF (3)

AA Sequence

MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQ      1 - 70
VKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGA     71 - 140
EVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQ    141 - 210
PNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSS    211 - 280
YWSYRPF                                                                   281 - 287
//

Text Mined References (15)

PMID Year Title