Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.90
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.45094105642072E-11
osteosarcoma 7933 1.20266620306665E-7
malignant mesothelioma 3163 2.09172122600136E-7
posterior fossa group B ependymoma 1530 5.62106663795488E-6
atypical teratoid / rhabdoid tumor 4369 5.71379560769013E-5
medulloblastoma 1524 0.00169014362500405
psoriasis 6685 0.00554564466208313
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0191297304059102

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
psoriasis -1.300 0.006
osteosarcoma -3.302 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma 1.100 0.002
intraductal papillary-mucinous neoplasm ... -1.200 0.019
posterior fossa group B ependymoma 1.100 0.000
lung carcinoma -1.200 0.000

Synonym

Accession Q9GZN6 Q8IYV4 Q9Y5I9
Symbols NT5
NTT5

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

AA Sequence

MKTEAQPSTSLLANTSWTGTVISDSVPGSQTWEDKGSLTRSATSWTSEAQVSAARVAEAQARTSQPKQIS      1 - 70
VLEALTASALNQKPTHEKVQMTEKKESEVLLARPFWSSKTEYILAQVGFSMKPSCLWRFAYLWLNSGGCS     71 - 140
FAAIYIFMLFLVGVPLLFLEMAAGQSMRQGGMGVWKIIAPWIGGVGYSSFMVCFILGLYFNVVNSWIIFY    141 - 210
MSQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSPVYSLVLPFFLCWCLVG    211 - 280
AFMINGLKSTGKVIYVLVLLPCFIIVGFFIRTLLLEGAKFGLQQLVVAKISDVYNMSVWSLAGGQVLSNT    281 - 350
GIGLGSVASLASYMPQSNNCLSDAFLVSVINLLTLLVFTSFNFCVLGFWATVITHRCCERNAEILLKLIN    351 - 420
LGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSF    421 - 490
LPPSVFWSFIFFLMLLAMGLSSAIGIMQGIITPLQDTFSFFRKHTKLLIVGVFLLMFVCGLFFTRPSGSY    491 - 560
FIRLLSDYWIVFPIIVVVVFETMAVSWAYGARRFLADLTILLGHPISPIFGWLWPHLCPVVLLIIFVTMM    561 - 630
VHLCMKPITYMSWDSSTSKEVLRPYPPWALLLMITLFAIVILPIPAYFVYCRIHRIPFRPKSGDGPMTAS    631 - 700
TSLPLSHQLTPSKEVQKEEILQVDETKYPSTCNVTS                                      701 - 736
//

Text Mined References (7)

PMID Year Title
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11112352 2000 Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na+/Cl- -dependent neurotransmitter transporter gene family.
10471414 1999 Neurotransmitter transporters in the central nervous system.