Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.55
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.100 4.8e-04
cystic fibrosis 1.200 4.1e-04
group 4 medulloblastoma -1.100 2.6e-04
lung adenocarcinoma 1.700 1.5e-09
medulloblastoma, large-cell -1.100 1.0e-04
psoriasis 1.700 7.9e-08

Synonym

Accession Q9GZN4 O43342 Q6UXE0 BSSP-4
Symbols BSSP-4
SP001LA
hBSSP-4

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVVSGAPPALGGGCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKN      1 - 70
GTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACA     71 - 140
DIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSH    141 - 210
LYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSA    211 - 280
HRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS                                     281 - 317
//

Text Mined References (9)

PMID Year Title