Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.78
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 6.07086466719306E-129
lung adenocarcinoma 2714 1.5442251294255E-9
medulloblastoma, large-cell 6234 1.00060068934397E-4
group 4 medulloblastoma 1875 2.56349224823329E-4
cystic fibrosis 1670 4.11514438583463E-4
breast carcinoma 1614 4.79518403717948E-4

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 3.300 0.000
medulloblastoma, large-cell -1.100 0.000
breast carcinoma 1.100 0.000
cystic fibrosis 1.200 0.000
group 4 medulloblastoma -1.100 0.000
lung adenocarcinoma 1.700 0.000

Synonym

Accession Q9GZN4 O43342 Q6UXE0 BSSP-4
Symbols BSSP-4
SP001LA
hBSSP-4

Gene

PANTHER Protein Class (3)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
24980078 Our findings collectively support a potential role of T3 in cancer cell progression through regulation of the BSSP4 protease via the ERK 1/2-C/EBPbeta-VEGF cascade
16176265 prosemin is a novel serine protease of the chromosome 16 cluster that is highly expressed in the pancreas.
15701722 Tryptase epsilon also was able to induce pro-uPA-expressing smooth muscle cells to increase their migration

AA Sequence

MVVSGAPPALGGGCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKN      1 - 70
GTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACA     71 - 140
DIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSH    141 - 210
LYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSA    211 - 280
HRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS                                     281 - 317
//

Text Mined References (9)

PMID Year Title
24980078 2014 Thyroid hormone enhanced human hepatoma cell motility involves brain-specific serine protease 4 activation via ERK signaling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16176265 2005 A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells.
15701722 2005 Urokinase-type plasminogen activator is a preferred substrate of the human epithelium serine protease tryptase epsilon/PRSS22.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11602603 2001 Human tryptase epsilon (PRSS22), a new member of the chromosome 16p13.3 family of human serine proteases expressed in airway epithelial cells.