Property Summary

NCBI Gene PubMed Count 27
PubMed Score 17.56
PubTator Score 16.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.000 7.8e-09
ependymoma 1.400 5.2e-10
glioblastoma 1.300 3.3e-04
malignant mesothelioma 2.000 3.1e-06
medulloblastoma 1.300 2.2e-03
medulloblastoma, large-cell 1.700 8.6e-04
osteosarcoma -1.349 6.9e-05
pediatric high grade glioma 1.600 1.4e-04
primitive neuroectodermal tumor 1.300 3.0e-04
psoriasis -1.800 3.7e-04

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI      1 - 70
NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE     71 - 140
KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA    141 - 210
EMELQKQQDPSLPLLHTPIPLVSENPQ                                               211 - 237
//

Text Mined References (27)

PMID Year Title