Property Summary

NCBI Gene PubMed Count 24
Grant Count 15
R01 Count 13
Funding $1,095,057.68
PubMed Score 15.42
PubTator Score 16.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 2.500 0.000
psoriasis -2.000 0.001
osteosarcoma -1.349 0.000
ependymoma 1.900 0.000
glioblastoma 1.600 0.002
sonic hedgehog group medulloblastoma 2.800 0.000
atypical teratoid/rhabdoid tumor 2.700 0.000
medulloblastoma, large-cell 1.800 0.002
primitive neuroectodermal tumor 1.800 0.000
pediatric high grade glioma 1.600 0.000

Gene RIF (4)

PMID Text
26638007 expression of miR-148a was regulated by DNA methylation and targeted by TGIF2. Its methylation may be a potential prognostic indicator in skin cancer
26464633 miR-34a could inhibit tumor invasion and metastasis in gastric cancer by targeting Tgif2
26330748 Corneal fibroblasts demonstrate the expression of TGIF1 and TGIF2 transcription factors. These transcriptional repressors are critical, at least partially, in mediating the antifibrotic effect of vorinostat in the cornea.
20040491 Shows that the homologous mouse Tgif2 gene is necessary for gastrulation.

AA Sequence

MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI      1 - 70
NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE     71 - 140
KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA    141 - 210
EMELQKQQDPSLPLLHTPIPLVSENPQ                                               211 - 237
//

Text Mined References (24)

PMID Year Title
26638007 2015 Down-Regulation of miR-148a Promotes Metastasis by DNA Methylation and is Associated with Prognosis of Skin Cancer by Targeting TGIF2.
26464633 2015 MicroRNA-34a inhibits tumor invasion and metastasis in gastric cancer by targeting Tgif2.
26330748 2015 Role of 5'TG3'-interacting factors (TGIFs) in Vorinostat (HDAC inhibitor)-mediated Corneal Fibrosis Inhibition.
22783022 2012 The Sin3a repressor complex is a master regulator of STAT transcriptional activity.
20040491 2010 Tgif1 and Tgif2 regulate Nodal signaling and are required for gastrulation.
19086843 2008 Identification of microRNAs caused by DNA methylation that induce metastasis.
18959792 2008 Integrating chromosomal aberrations and gene expression profiles to dissect rectal tumorigenesis.
18768788 2008 A microRNA DNA methylation signature for human cancer metastasis.
18094028 2008 The Gata5 target, TGIF2, defines the pancreatic region by modulating BMP signals within the endoderm.
16962354 2007 Functional analysis of mutations in TGIF associated with holoprosencephaly.
More...