Property Summary

NCBI Gene PubMed Count 3
Grant Count 6
Funding $432,113.5
PubMed Score 23.34
PubTator Score 7.79

Knowledge Summary

Patent (3,711)

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -2.500 0.001
astrocytoma -1.100 0.000
glioblastoma -3.500 0.000
osteosarcoma -3.356 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
sonic hedgehog group medulloblastoma -2.700 0.006
medulloblastoma, large-cell -3.400 0.006
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -3.000 0.000

AA Sequence

MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFI      1 - 70
VNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYL     71 - 140
LITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLH    141 - 210
CYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRR    211 - 280
LSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSV    281 - 350
LPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW                                        351 - 384
//

Text Mined References (6)

PMID Year Title
27123486 2016 Deleterious mutation in GPR88 is associated with chorea, speech delay, and learning disabilities.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11056049 2000 A novel G-protein-coupled receptor gene expressed in striatum.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.