Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.01
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis -2.000 0.000
osteosarcoma -1.641 0.000

Gene RIF (2)

PMID Text
25521548 TINAGL1 and B3GALNT1 are possible candidates for drug compounds that inhibit their gene expression
25514977 Double immunofluorescence analysis showed that CTLA-2alpha was co-localized with cathepsin L, cathepsin C, and TINAGL1 in placenta.

AA Sequence

MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI      1 - 70
CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC     71 - 140
LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS    141 - 210
EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW    211 - 280
FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND    281 - 350
KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY    351 - 420
WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH                           421 - 467
//

Text Mined References (24)

PMID Year Title
25521548 2014 TINAGL1 and B3GALNT1 are potential therapy target genes to suppress metastasis in non-small cell lung cancer.
25514977 2015 Identification and characterization of the interactive proteins with cytotoxic T-lymphocyte antigen-2?.
25416956 2014 A proteome-scale map of the human interactome network.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...