Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.94
PubTator Score 10.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma 1.100 0.018
diabetes mellitus -1.300 0.001
ovarian cancer 1.600 0.000

Synonym

Accession Q9GZM5 Q5JTD2 Q6FI85 Q8NI57 Q9NWE3 Q9Y3U9
Symbols KLIP1
FinGER3
C6orf109
dJ337H4.3

Gene

 GO Process (1)

Gene RIF (2)

PMID Text
21757827 YIPF3 is synthesized in the ER as a N-glycosylated form (40 kDa), is then O-glycosylated in the Golgi apparatus to become a lower mobility form (46 kDa) and finally becomes a higher mobility form cleaved at its C-terminal luminal domain (36 kDa).
12490290 identification and characterization of KLIP-1, a novel transmembrane protein whose expression correlates with hematopoietic activity

AA Sequence

MATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAA      1 - 70
AAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRPYFDVEPAQVRSRLLESMIPI     71 - 140
KMVNFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTLMGTAIGTCFGYWLGVSSFIYFLAYLCN    141 - 210
AQITMLQMLALLGYGLFGHCIVLFITYNIHLHALFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGT    211 - 280
LAALHMLFLLYLHFAYHKVVEGILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH    281 - 350
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21757827 2011 Characterization of YIPF3 and YIPF4, cis-Golgi Localizing Yip domain family proteins.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...