Property Summary

NCBI Gene PubMed Count 17
PubMed Score 22.58
PubTator Score 10.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
ovarian cancer 8520 4.0e-06
diabetes mellitus 1728 1.2e-03
astrocytoma 1146 1.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma 1.100 1.8e-02
diabetes mellitus -1.300 1.2e-03
ovarian cancer 1.600 4.0e-06

Gene RIF (4)

AA Sequence

MATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAA      1 - 70
AAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRPYFDVEPAQVRSRLLESMIPI     71 - 140
KMVNFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTLMGTAIGTCFGYWLGVSSFIYFLAYLCN    141 - 210
AQITMLQMLALLGYGLFGHCIVLFITYNIHLHALFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGT    211 - 280
LAALHMLFLLYLHFAYHKVVEGILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH    281 - 350
//

Text Mined References (21)

PMID Year Title