Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MGGRDQITNLGSEGETHPWGYSSPPYPLHTFFIPFLPSGFGGSGLGIPSDNEKHDLQDCVEVSRPEGPAP      1 - 70
ELPSSLCGWNKISSLCGLGFPSRDPKTWDLAMLLSPWVDFFELQLL                             71 - 116
//

Text Mined References (4)

PMID Year Title