Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 4
Funding $1,334,895
PubMed Score 20.29
PubTator Score 6.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.202 0.002
psoriasis 2.200 0.000
osteosarcoma -1.579 0.000
glioblastoma 1.200 0.002
non-small cell lung cancer 1.453 0.000
lung cancer 3.100 0.000
adult high grade glioma -1.200 0.000
ovarian cancer 1.300 0.001

Synonym

Accession Q9GZL7 B3KPA9 Q96HU0 Q9NV80 Q9NYI8
Symbols YTM1

Gene

Gene RIF (7)

PMID Text
25915632 MI associated WDR12 allele was associated significantly with diastolic dysfunction and left atrial size.
25825154 The DDX27 can interact specifically with the Pes1 and Bop1 but fulfils critical function(s) for proper 3' end formation of 47S rRNA independently of the PeBoW-complex.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17353269 Results describe the role of PeBoW-specific proteins Pes1, Bop1, and WDR12 in complex assembly and stability, nucleolar transport, and pre-ribosome association.
16043514 WDR12 triggers accumulation of p53 in a p19ARF-independent manner in proliferating cells but not in quiescent cells.

AA Sequence

MAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHM      1 - 70
EMENISSEEVVEIEYVEKYTAPQPEQCMFHDDWISSIKGAEEWILTGSYDKTSRIWSLEGKSIMTIVGHT     71 - 140
DVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWD    141 - 210
KMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQLGLTRTPIVTLSGHMEAVSSVLWSDAEEICSASWDHTI    211 - 280
RVWDVESGSLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKW    281 - 350
SPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH    351 - 420
VGA                                                                       421 - 423
//

Text Mined References (23)

PMID Year Title
25915632 2015 WDR12, a Member of Nucleolar PeBoW-Complex, Is Up-Regulated in Failing Hearts and Causes Deterioration of Cardiac Function.
25825154 2015 DEAD-box helicase DDX27 regulates 3' end formation of ribosomal 47S RNA and stably associates with the PeBoW-complex.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...