Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.38
PubTator Score 1.05

Knowledge Summary

Patent (213)

Gene RIF (2)

AA Sequence

MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKPMYIFLANLSF      1 - 70
LDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMAYDRYLAICYPLHYPLLMGPR     71 - 140
RYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYCDFMLFVGLACSDPRVAQVTTLILSVFCLTI    141 - 210
PFGLILTSYARIVVAVLRVPAGASRRRAFSTCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYT    211 - 280
VVTPLFNPVIYTMRNKEVHQALRKILCIKQTETLD                                       281 - 315
//

Text Mined References (6)

PMID Year Title