Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $111,979.67
PubMed Score 1.98
PubTator Score 52.54

Knowledge Summary

Patent (115)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.142 0.000
atypical teratoid / rhabdoid tumor 1.100 0.004
medulloblastoma, large-cell 1.600 0.000
Multiple Sclerosis 1.500 0.004
adult high grade glioma 1.300 0.001
ulcerative colitis -1.300 0.000
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
20466734 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFFLSDLSFLDLC      1 - 70
FTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCW     71 - 140
QLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLS    141 - 210
LILASYGATAQAVLRINSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGT    211 - 280
PSLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA                                      281 - 316
//

Text Mined References (10)

PMID Year Title
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20466734 2010 Refining the association of MHC with multiple sclerosis in African Americans.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.