Tdark | Olfactory receptor 2H1 |
Odorant receptor.
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 1.40938452289911E-10 |
osteosarcoma | 7933 | 3.86753781250039E-5 |
medulloblastoma, large-cell | 6234 | 6.46807233739173E-5 |
ulcerative colitis | 2087 | 6.94243383336411E-5 |
adult high grade glioma | 2148 | 6.57094228245264E-4 |
atypical teratoid / rhabdoid tumor | 4369 | 0.00366966858478002 |
Multiple Sclerosis | 498 | 0.00426332153991161 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Rheumatoid Arthritis | 1171 | 0.0 | 2.0 |
Type 1 diabetes mellitus | 104 | 0.0 | 2.0 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | 1.142 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.100 | 0.004 |
medulloblastoma, large-cell | 1.600 | 0.000 |
Multiple Sclerosis | 1.500 | 0.004 |
adult high grade glioma | 1.300 | 0.001 |
ulcerative colitis | -1.300 | 0.000 |
ovarian cancer | 1.100 | 0.000 |
MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFFLSDLSFLDLC 1 - 70 FTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCW 71 - 140 QLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLS 141 - 210 LILASYGATAQAVLRINSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGT 211 - 280 PSLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA 281 - 316 //
PMID | Year | Title |
---|---|---|
22610502 | 2012 | Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients. |
20466734 | 2010 | Refining the association of MHC with multiple sclerosis in African Americans. |
19851445 | 2009 | High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14983052 | 2004 | The human olfactory receptor gene family. |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
14574404 | 2003 | The DNA sequence and analysis of human chromosome 6. |
12637542 | 2003 | Complex transcription and splicing of odorant receptor genes. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |