Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (390)

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

MNWVNKSVPQEFILLVFSDQPWLEIPPFVMFLFSYILTIFGNLTIILVSHVDFKLHTPMYFFLSNLSLLD      1 - 70
LCYTTSTVPQMLVNICNTRKVISYGGCVAQLFIFLALGSTECLLLAVMCFDRFVAICRPLHYSIIMHQRL     71 - 140
CFQLAAASWISGFSNSVLQSTWTLKMPLCGHKEVDHFFCEVPALLKLSCVDTTANEAELFFISVLFLLIP    141 - 210
VTLILISYAFIVQAVLRIQSAEGQRKAFGTCGSHLIVVSLFYGTAISMYLQPPSPSSKDRGKMVSLFCGI    211 - 280
IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTYLTNFSASCPIFVITIENYCN    281 - 350
LPQRKFP                                                                   351 - 357
//

Text Mined References (4)

PMID Year Title