Property Summary

NCBI Gene PubMed Count 2,525
PubMed Score 0.00
PubTator Score 5085.80

Knowledge Summary

Patent

No data available

Gene RIF (2749)

AA Sequence

MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFD      1 - 70
SDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQH     71 - 140
YNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT    141 - 210
SPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS                  211 - 266
//

Text Mined References (2550)

PMID Year Title