Property Summary

NCBI Gene PubMed Count 2
PubMed Score 135.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9GIP4 Q6IPZ0 Q8MH62
Symbols IMAA
MMAA

Gene

AA Sequence

MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIVVAIMSSGIFV      1 - 70
TPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLII     71 - 140
RPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQLIVHQPTQVI                        141 - 190
//

Text Mined References (3)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12009310 2002 Up-regulated expression of a novel gene in activated human peripheral blood mononuclear cells that is a truncated paralog of the human system L-amino acid transporter 1.