Property Summary

NCBI Gene PubMed Count 2
PubMed Score 156.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.12 2.1
Lysinuric protein intolerance 15 3.888 1.9

AA Sequence

MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIVVAIMSSGIFV      1 - 70
TPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLII     71 - 140
RPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQLIVHQPTQVI                        141 - 190
//

Text Mined References (3)

PMID Year Title