Property Summary

NCBI Gene PubMed Count 15
Grant Count 10
R01 Count 10
Funding $1,321,007.75
PubMed Score 9.95
PubTator Score 6.46

Knowledge Summary

Patent (2,043)

Expression

Synonym

Accession Q9C0K7 Q5BKY7 Q9P1L0 STRAD beta
Symbols PAPK
ILPIP
ILPIPA
ALS2CR2
CALS-21
PRO1038

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (1)

PMID Text
12048196 a novel XIAP-interacting protein that acts as a co-factor enhancing XIAP-mediated activation of JNK1 and the caspase-independent protection of XIAP against apoptosis

AA Sequence

MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDN      1 - 70
LTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMA     71 - 140
YGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLV    141 - 210
KHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQK    211 - 280
LKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCL    281 - 350
QQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF      351 - 418
//

Text Mined References (16)

PMID Year Title
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
20562859 2010 Network organization of the human autophagy system.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16879967 2006 Emerging roles of pseudokinases.
16756488 2006 LKB1-dependent signaling pathways.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
More...