Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.95
PubTator Score 6.46

Knowledge Summary

Patent (2,043)

Expression

Synonym

Accession Q9C0K7 Q5BKY7 Q9P1L0 STRAD beta
Symbols PAPK
ILPIP
ILPIPA
ALS2CR2
CALS-21
PRO1038

Gene

  Ortholog (12)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (1)

PMID Text
12048196 a novel XIAP-interacting protein that acts as a co-factor enhancing XIAP-mediated activation of JNK1 and the caspase-independent protection of XIAP against apoptosis

AA Sequence

MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDN      1 - 70
LTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMA     71 - 140
YGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLV    141 - 210
KHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQK    211 - 280
LKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCL    281 - 350
QQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF      351 - 418
//

Text Mined References (16)

PMID Year Title
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
20562859 2010 Network organization of the human autophagy system.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16879967 2006 Emerging roles of pseudokinases.
16756488 2006 LKB1-dependent signaling pathways.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
More...