Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.50
PubTator Score 6.46

Knowledge Summary

Patent (2,043)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Synonym

Accession Q9C0K7 Q5BKY7 Q9P1L0 STRAD beta
Symbols PAPK
ILPIP
ILPIPA
ALS2CR2
CALS-21
PRO1038

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (9)

Gene RIF (1)

AA Sequence

MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDN      1 - 70
LTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMA     71 - 140
YGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLV    141 - 210
KHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQK    211 - 280
LKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCL    281 - 350
QQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF      351 - 418
//

Text Mined References (16)

PMID Year Title