Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.48
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.588 4.7e-04
adult high grade glioma -1.100 2.5e-04
astrocytic glioma -1.600 2.8e-03
atypical teratoid / rhabdoid tumor -1.100 2.1e-04
ependymoma -1.500 7.4e-03
medulloblastoma -1.100 5.1e-06
medulloblastoma, large-cell -1.200 5.3e-04
oligodendroglioma -1.500 3.8e-03
pancreatic ductal adenocarcinoma liver m... -2.226 1.0e-03
primitive neuroectodermal tumor -1.200 2.2e-03
psoriasis 1.100 3.3e-65

AA Sequence

MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRD      1 - 70
ITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGINAINQKKFVI     71 - 140
DVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKMEQIPLSYPQGHGFHPLSPPFH    141 - 210
//

Text Mined References (6)

PMID Year Title