Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.29
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

AA Sequence

MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRD      1 - 70
ITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGINAINQKKFVI     71 - 140
DVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKMEQIPLSYPQGHGFHPLSPPFH    141 - 210
//

Text Mined References (6)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14651955 2003 Expression of the Arp11 gene suppresses the tumorigenicity of PC-14 human lung adenocarcinoma cells.
11162478 2001 Isolation of a novel actin-related gene expressed in low-metastatic PC-14 human lung adenocarcinoma.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.