Property Summary

NCBI Gene PubMed Count 27
PubMed Score 56.46
PubTator Score 26.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 6.47679873092734E-41
non-small cell lung cancer 2798 1.27909038513247E-26
periodontitis 269 5.09526656533912E-20
lung adenocarcinoma 2714 2.4637101525427E-11
ovarian cancer 8492 4.46749738211411E-9
malignant mesothelioma 3163 1.09267674460254E-8
glioblastoma multiforme 347 1.27883439980338E-8
cystic fibrosis 1670 1.49286993818717E-8
juvenile dermatomyositis 1189 4.33152690417912E-7
tuberculosis and treatment for 3 months 327 4.66048507161241E-6
lung cancer 4473 6.11817526484966E-6
interstitial cystitis 2299 1.2863916852538E-4
atypical teratoid / rhabdoid tumor 4369 2.01455855252874E-4
Multiple myeloma 1328 3.01374157716396E-4
primary pancreatic ductal adenocarcinoma 1271 3.49244737966952E-4
psoriasis 6685 5.41506558832986E-4
adrenocortical carcinoma 1427 6.99909002700982E-4
medulloblastoma, large-cell 6234 9.36306901280777E-4
pancreatic cancer 2300 0.00194368301388109
adult high grade glioma 2148 0.00227237716509604
active Crohn's disease 918 0.00241117136473564
group 4 medulloblastoma 1875 0.00618428529315918
Waldenstrons macroglobulinemia 765 0.0183043972902549
head and neck cancer 270 0.0198340272293781
Breast cancer 3099 0.0237535027308865
Rheumatoid Arthritis 1171 0.0247017166257453
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0386985394832649
subependymal giant cell astrocytoma 2287 0.0403601053416472
Gaucher disease type 3 76 0.0466715137951998
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 3.184 1.6
Disease Target Count Z-score Confidence
Osteoarthritis 96 3.147 1.6

Expression

Synonym

Accession Q9C0K1 B4E2H3 Q96SM9 Q9BVC0 Q9NSA4
Symbols ZIP8
CDG2N
PP3105
BIGM103
LZT-Hs6

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (14)

PMID Text
26637978 Autosomal-recessive intellectual disability with cerebellar atrophy syndrome is caused by mutation of the manganese and zinc transporter gene SLC39A8.
26025379 The lead single nucleotide polymorphism (SNP) in the 4q24 locus was rs13107325 (P-value = 5.1 x 10(-11), beta = -0.77), located in an exon of SLC39A8, which encodes a protein involved in manganese and zinc transport.
26006263 data provide evidence of positive selection on a schizophrenia risk SNP rs13107325 in the SLC39A8 gene, and we propose a hypothesis about the relationship among positive selection of host alleles, schizophrenia, hypertension, energy intake, and the unique history of Europeans.
24514587 Polymorphisms in SLC39A14 and SLC39A8 seemed to affect blood cadmium concentrations, for SLC39A14 this effect may occur via differential gene expression.
23921484 Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls.
23688035 MicroRNA-488 regulates zinc transporter SLC39A8/ZIP8 during pathogenesis of osteoarthritis
23403290 The zinc transporter SLC39A8 (ZIP8) is a transcriptional target of NF-kappaB and functions to negatively regulate proinflammatory responses through zinc-mediated down-modulation of IkappaB kinase (IKK) activity in vitro.
22898811 data identify ZIP8 as an iron transport protein that may function in iron metabolism.
22078303 findings reveal a role for brain metal homeostasis in psychosis.
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLH      1 - 70
FNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIIN     71 - 140
LASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAVAVFGGFYLLF    141 - 210
FFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQ    211 - 280
DGKKEPSSCTCLKGPKLSEIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELG    281 - 350
DFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLR    351 - 420
EKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE                                  421 - 460
//

Text Mined References (31)

PMID Year Title
26637979 2015 SLC39A8 Deficiency: A Disorder of Manganese Transport and Glycosylation.
26637978 2015 Autosomal-Recessive Intellectual Disability with Cerebellar Atrophy Syndrome Caused by Mutation of the Manganese and Zinc Transporter Gene SLC39A8.
26025379 2015 Genome-wide association study of toxic metals and trace elements reveals novel associations.
26006263 2016 Recent Positive Selection Drives the Expansion of a Schizophrenia Risk Nonsynonymous Variant at SLC39A8 in Europeans.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24514587 2014 Cadmium concentrations in human blood and urine are associated with polymorphisms in zinc transporter genes.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23921484 2013 Zip1, Zip2, and Zip8 mRNA expressions were associated with growth hormone level during the growth hormone provocation test in children with short stature.
23688035 2013 MicroRNA-488 regulates zinc transporter SLC39A8/ZIP8 during pathogenesis of osteoarthritis.
23403290 2013 ZIP8 regulates host defense through zinc-mediated inhibition of NF-?B.
More...