Property Summary

NCBI Gene PubMed Count 31
PubMed Score 66.76
PubTator Score 26.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 1.474 2.4e-03
adrenocortical carcinoma 1.816 7.0e-04
adult high grade glioma -1.200 2.3e-03
atypical teratoid / rhabdoid tumor -1.100 2.0e-04
Breast cancer 2.700 2.4e-02
cystic fibrosis 4.451 1.5e-08
Gaucher disease type 3 -1.800 4.7e-02
glioblastoma -1.300 6.1e-04
group 3 medulloblastoma -1.100 7.1e-03
head and neck cancer 1.300 2.0e-02
interstitial cystitis 1.200 1.3e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.9e-02
juvenile dermatomyositis -1.043 4.3e-07
lung adenocarcinoma -1.700 7.3e-09
lung cancer -1.700 4.2e-04
lung carcinoma -3.800 6.5e-41
malignant mesothelioma -3.500 3.6e-09
medulloblastoma, large-cell -1.100 9.4e-04
Multiple myeloma 2.107 3.0e-04
non-small cell lung cancer -2.881 1.3e-26
ovarian cancer -4.400 4.5e-09
pancreatic cancer -1.300 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.188 1.0e-02
periodontitis 1.100 5.1e-20
psoriasis -1.400 5.4e-04
Rheumatoid arthritis 1.600 2.5e-02
subependymal giant cell astrocytoma 1.440 4.0e-02
tuberculosis -3.000 3.9e-08
Waldenstrons macroglobulinemia 1.393 1.8e-02

Gene RIF (18)

AA Sequence

MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLH      1 - 70
FNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIIN     71 - 140
LASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAVAVFGGFYLLF    141 - 210
FFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQ    211 - 280
DGKKEPSSCTCLKGPKLSEIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELG    281 - 350
DFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLR    351 - 420
EKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE                                  421 - 460
//

Text Mined References (35)

PMID Year Title