Property Summary

NCBI Gene PubMed Count 43
PubMed Score 125.21
PubTator Score 75.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.74866636411995E-8
Breast cancer 3099 3.91374649209678E-4
primary Sjogren syndrome 789 0.00159582276787798
ependymoma 2514 0.00170365856695034
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00218589409214691
glioblastoma 5572 0.00300601645232184
astrocytic glioma 2241 0.00451413558029565
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00792181410440767
oligodendroglioma 2849 0.00891193974631336
progressive supranuclear palsy 674 0.01132136320771
Pick disease 1893 0.0145329974836174
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0149710129802436
sarcoidosis 368 0.0153252573014195
osteosarcoma 7933 0.0210708265701698
interstitial cystitis 2299 0.021093109568541
atypical teratoid / rhabdoid tumor 4369 0.021945820939658
ductal carcinoma in situ 1745 0.0223738737812447
lung cancer 4473 0.0320971860357084
Hydrolethalus syndrome 128 0.0362624571621455
Disease Target Count Z-score Confidence
Leukemia 88 4.194 2.1

Expression

Synonym

Accession Q9C0K0 Q9H162 BCL-11B
Symbols ATL1
RIT1
CTIP2
CTIP-2
ZNF856B
ATL1-beta
ATL1-alpha
ATL1-delta
ATL1-gamma
hRIT1-alpha

Gene

  Ortholog (9)

 GWAS Trait (1)

Gene RIF (39)

PMID Text
25827435 BCL11B introduction in human cell lines downregulated transcription of beta-catenin target genes, whereas Bcl11b attenuation in Lgr5(+) crypt base columnar cells increased expression of beta-catenin targets including c-Myc and cyclin D1.
25613934 Tax is responsible for suppressing BCL11B protein expression in HTLV-1-infected T-cells; Tax-mediated repression of BCL11B is another mechanism that Tax uses to promote oncogenesis of HTLV-1-infected T-cells.
25128552 a comprehensive review of the roles of Bcl11b in progenitors, effector T cells, regulatory T cells, and invariant NKT cells, as well as its impact on immune diseases.
25023966 low BCL11b expression was associated with poor prognosis; particularly in the standard risk group of thymic T-cell acute lymphoblastic leukemia
24441149 Integrated genome-wide genotyping and gene expression profiling reveals BCL11B as a putative oncogene in acute myeloid leukemia with 14q32 aberrations.
23852730 CTIP2 controls P-TEFb function in physiological and pathological conditions.
23803414 LSD1 interacts with CTIP2 and co-localizes with HIV-1 Tat. LSD1 is required for CTIP2 recruitment at the HIV-1 proximal promoter to repress HIV-1 replication and transcription
23682716 overexpressed in mycosis fungoides lesions
23527175 BCL11B is up-regulated by EWS/FLI and contributes to the transformed phenotype in Ewing sarcoma.
23383087 a reduction in the level of the BCL11B protein is a key event in the multistep progression of ATLL leukemogenesis
More...

AA Sequence

MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQCQMNFPLGDI      1 - 70
LVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTPDEDDHLLSPTKGICPKQEN     71 - 140
IAGPCRPAQLPAVAPIAASSHPHSSVITSPLRALGALPPCLPLPCCSARPVSGDGTQGEGQTEAPFGCQC    141 - 210
QLSGKDEPSSYICTTCKQPFNSAWFLLQHAQNTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLM    211 - 280
NFLGDSNPFNLLRMTGPILRDHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMR    281 - 350
LNPMAIDSPAMDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPP    351 - 420
QPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLAGRSDD    421 - 490
GLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEEEELLLENESRPESSFSMDS    491 - 560
ELSRNRENGGGGVPGVPGAGGGAAKALADEKALVLGKVMENVGLGALPQYGELLADKQKRGAFLKRAAGG    561 - 630
GDAGDDDDAGGCGDAGAGGAVNGRGGGFAPGTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAA    631 - 700
LIPSENVYSQWLVGYAASRHFMKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGT    701 - 770
ASGGSTPHLGGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLT    771 - 840
RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS                    841 - 894
//

Text Mined References (49)

PMID Year Title
25827435 2015 Bcl11b SWI/SNF-complex subunit modulates intestinal adenoma and regeneration after ?-irradiation through Wnt/?-catenin pathway.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25613934 2015 Human T-cell leukemia virus type 1 Tax oncoprotein represses the expression of the BCL11B tumor suppressor in T-cells.
25128552 2014 The multifaceted roles of Bcl11b in thymic and peripheral T cells: impact on immune diseases.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25023966 2014 Low expression of T-cell transcription factor BCL11b predicts inferior survival in adult standard risk T-cell acute lymphoblastic leukemia patients.
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24441149 2014 Integrated genome-wide genotyping and gene expression profiling reveals BCL11B as a putative oncogene in acute myeloid leukemia with 14q32 aberrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23852730 2013 CTIP2 is a negative regulator of P-TEFb.
More...