Property Summary

NCBI Gene PubMed Count 49
PubMed Score 140.39
PubTator Score 75.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.200 5.5e-03
atypical teratoid / rhabdoid tumor -1.400 2.2e-02
Breast cancer -1.300 3.9e-04
ductal carcinoma in situ 1.200 3.0e-02
ependymoma -1.900 1.7e-03
glioblastoma -1.700 3.0e-03
Hydrolethalus syndrome -1.825 3.6e-02
interstitial cystitis 1.200 2.1e-02
intraductal papillary-mucinous adenoma (... 1.900 3.1e-03
intraductal papillary-mucinous carcinoma... 1.700 9.1e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.5e-02
lung cancer -1.700 3.2e-02
non primary Sjogren syndrome sicca -1.100 2.2e-02
non-small cell lung cancer 1.336 2.7e-08
oligodendroglioma -1.300 1.7e-02
osteosarcoma -2.036 2.1e-02
Pick disease 1.300 1.5e-02
progressive supranuclear palsy 1.300 1.1e-02
sarcoidosis 1.600 1.5e-02

Gene RIF (44)

AA Sequence

MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQCQMNFPLGDI      1 - 70
LVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTPDEDDHLLSPTKGICPKQEN     71 - 140
IAGPCRPAQLPAVAPIAASSHPHSSVITSPLRALGALPPCLPLPCCSARPVSGDGTQGEGQTEAPFGCQC    141 - 210
QLSGKDEPSSYICTTCKQPFNSAWFLLQHAQNTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLM    211 - 280
NFLGDSNPFNLLRMTGPILRDHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMR    281 - 350
LNPMAIDSPAMDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPP    351 - 420
QPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLAGRSDD    421 - 490
GLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEEEELLLENESRPESSFSMDS    491 - 560
ELSRNRENGGGGVPGVPGAGGGAAKALADEKALVLGKVMENVGLGALPQYGELLADKQKRGAFLKRAAGG    561 - 630
GDAGDDDDAGGCGDAGAGGAVNGRGGGFAPGTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAA    631 - 700
LIPSENVYSQWLVGYAASRHFMKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGT    701 - 770
ASGGSTPHLGGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLT    771 - 840
RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS                    841 - 894
//

Text Mined References (56)

PMID Year Title