Property Summary

NCBI Gene PubMed Count 44
PubMed Score 112.12
PubTator Score 71.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
astrocytoma 2.300 6.6e-04
Atopic dermatitis -1.300 5.5e-05
atypical teratoid / rhabdoid tumor -2.000 2.0e-02
Barrett's esophagus 1.300 4.2e-02
Breast cancer -3.000 1.4e-16
breast carcinoma -1.500 1.1e-25
chronic kidney disease 1.200 3.7e-02
Chronic Lymphocytic Leukemia -1.197 1.1e-03
cystic fibrosis 2.154 8.9e-07
ependymoma 1.300 5.6e-03
gastric carcinoma 2.100 1.3e-02
glioblastoma 1.700 1.9e-02
group 3 medulloblastoma -2.900 8.5e-05
head and neck cancer -1.200 2.5e-02
interstitial cystitis -1.100 1.4e-02
invasive ductal carcinoma -1.600 1.4e-03
malignant mesothelioma -5.900 1.8e-09
medulloblastoma, large-cell -2.900 1.0e-02
nasopharyngeal carcinoma -1.200 9.4e-04
non-small cell lung cancer -1.032 1.0e-04
osteosarcoma 1.370 1.1e-02
ovarian cancer 3.100 1.9e-06
pancreatic cancer 1.300 3.0e-03
pediatric high grade glioma 1.500 7.5e-03
periodontitis 1.100 3.8e-22
pituitary cancer 1.300 1.1e-03
primary pancreatic ductal adenocarcinoma 1.196 1.3e-02
primitive neuroectodermal tumor -1.700 4.1e-02
psoriasis -2.000 4.3e-10
tuberculosis and treatment for 3 months -1.200 2.7e-04

 GO Component (1)

Gene RIF (36)

AA Sequence

MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDL      1 - 70
LPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAK     71 - 140
EVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQK    141 - 210
LEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM    211 - 280
KLDSRGGGSGGGPGGGAAAAAAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLP    281 - 350
FCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS    351 - 420
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP            421 - 482
//

Text Mined References (47)

PMID Year Title