Property Summary

NCBI Gene PubMed Count 39
Grant Count 17
R01 Count 15
Funding $958,966.01
PubMed Score 100.93
PubTator Score 71.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.197 0.001
malignant mesothelioma -5.900 0.000
Barrett's esophagus 1.300 0.042
psoriasis -2.000 0.000
osteosarcoma 1.370 0.011
ependymoma 1.300 0.006
sonic hedgehog group medulloblastoma -3.300 0.000
cystic fibrosis 2.154 0.000
astrocytoma 2.300 0.001
periodontitis 1.100 0.000
atypical teratoid/rhabdoid tumor -2.200 0.001
glioblastoma 2.000 0.006
medulloblastoma, large-cell -2.900 0.010
primitive neuroectodermal tumor -1.700 0.041
Atopic dermatitis -1.300 0.000
chronic kidney disease 1.200 0.037
tuberculosis and treatment for 3 months -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.196 0.013
non-small cell lung cancer -1.032 0.000
interstitial cystitis -1.300 0.001
pediatric high grade glioma 1.500 0.008
nasopharyngeal carcinoma -1.200 0.001
Breast cancer -3.000 0.000
breast carcinoma -1.500 0.000
gastric carcinoma 2.100 0.013
invasive ductal carcinoma -1.600 0.001
ovarian cancer 3.100 0.000
pituitary cancer 1.300 0.001
pancreatic cancer 1.300 0.003
head and neck cancer -1.200 0.025

 GO Component (1)

Gene RIF (31)

PMID Text
26710124 DEC2 is aberrantly expressed in rheumatoid arthritis tissue, it is induced by TNFalpha and not only affects the expression of genes belonging to molecular clock but also significantly impacts on the expression of IL-1beta as well as other inflammatory genes.
26391953 BHLHE40/41 are promising markers to predict the aggressiveness of each Endometrial Neoplasm case and that molecular targeting strategies involving BHLHE40/41 and SP1 may effectively regulate Endometrial Neoplasm progression.
25884381 DEC2 facilitates HIF-1alpha stabilization and promotes HIF-1 activation in osteosarcoma.
25524285 DEC2 participates in hypoxia-induced cell proliferation by functioning as a target gene of the PI3K/Akt signaling pathway and regulating the expression of c-Myc.
25446074 DEC2 regulates cellular function by modulating the expression of Twist1
25083013 BHLHE41 mutations reduce total sleep while maintaining NREM sleep and provide resistance to the effects of sleep loss; mutations that affect sleep also modify the normal inhibition of BHLHE41 of CLOCK/BMAL1 transactivation
24997474 Data suggest that SHARP1 plays a critical role in tumorigenesis and acquisition of the metastatic phenotype in endometrial cancer.
24918449 SHARP1 interacted with HIF-1alpha physically.
24561520 we find high frequency of RAS mutations in t(6;11)(q27;q23) pediatric AML and are the first to report a unique and significant differential overexpression of BHLHB3 in these patients.
24165159 GLI1 expression was immunohistochemically related positively with BHLHE41 and inversely with MLH1 in PDAC cells and precancerous lesions of the pancreas.
More...

AA Sequence

MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDL      1 - 70
LPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAK     71 - 140
EVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQK    141 - 210
LEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM    211 - 280
KLDSRGGGSGGGPGGGAAAAAAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLP    281 - 350
FCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS    351 - 420
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP            421 - 482
//

Text Mined References (41)

PMID Year Title
26710124 2015 Differentially Expressed in Chondrocytes 2 (DEC2) Increases the Expression of IL-1? and Is Abundantly Present in Synovial Membrane in Rheumatoid Arthritis.
26391953 2015 Regulation of the Mechanism of TWIST1 Transcription by BHLHE40 and BHLHE41 in Cancer Cells.
25884381 2015 DEC2 expression is positively correlated with HIF-1 activation and the invasiveness of human osteosarcomas.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25524285 2015 Involvement of c-Myc in the proliferation of MCF-7 human breast cancer cells induced by bHLH transcription factor DEC2.
25446074 2014 The basic helix-loop-helix (bHLH) transcription factor DEC2 negatively regulates Twist1 through an E-box element.
25083013 2014 A novel BHLHE41 variant is associated with short sleep and resistance to sleep deprivation in humans.
24997474 2014 Suppression of the epithelial-mesenchymal transition by SHARP1 is linked to the NOTCH1 signaling pathway in metastasis of endometrial cancer.
24918449 2014 SHARP1 suppresses angiogenesis of endometrial cancer by decreasing hypoxia-inducible factor-1? level.
24561520 2014 Unique BHLHB3 overexpression in pediatric acute myeloid leukemia with t(6;11)(q27;q23).
More...