Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
R01 Count 1
Funding $50,334.67
PubMed Score 3.27
PubTator Score 3.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9C0J8 Q05DP8 Q53FG9 Q587J1 Q69YF7 Q6NUQ0 Q9NUL1
Symbols NET14
WDC146

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (2)

PMID Text
25301781 showed that WDR33 binds in and very close to the AAUAAA signal in vivo with high specificity
25301780 unexpectedly found that CPSF subunits CPSF30 and Wdr33 directly contact AAUAAA

AA Sequence

MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENR      1 - 70
IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASS     71 - 140
GEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREASF    141 - 210
SPTDNKFATCSDDGTVRIWDFLRCHEERILRGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQS    211 - 280
LATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVAWHPVHEGLFASG    281 - 350
GSDGSLLFWHVGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLL    351 - 420
PGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQMGKDESNEIEMTIPGLDWGMEEVMQKDQKKVP    421 - 490
QKKVPYAKPIPAQFQQAWMQNKVPIPAPNEVLNDRKEDIKLEEKKKTQAEIEQEMATLQYTNPQLLEQLK    491 - 560
IERLAQKQVEQIQPPPSSGTPLLGPQPFPGQGPMSQIPQGFQQPHPSQQMPMNMAQMGPPGPQGQFRPPG    561 - 630
PQGQMGPQGPPLHQGGGGPQGFMGPQGPQGPPQGLPRPQDMHGPQGMQRHPGPHGPLGPQGPPGPQGSSG    631 - 700
PQGHMGPQGPPGPQGHIGPQGPPGPQGHLGPQGPPGTQGMQGPPGPRGMQGPPHPHGIQGGPGSQGIQGP    701 - 770
VSQGPLMGLNPRGMQGPPGPRENQGPAPQGMIMGHPPQEMRGPHPPGGLLGHGPQEMRGPQEIRGMQGPP    771 - 840
PQGSMLGPPQELRGPPGSQSQQGPPQGSLGPPPQGGMQGPPGPQGQQNPARGPHPSQGPIPFQQQKTPLL    841 - 910
GDGPRAPFNQEGQSTGPPPLIPGLGQQGAQGRIPPLNPGQGPGPNKGDSRGPPNHHMGPMSERRHEQSGG    911 - 980
PEHGPERGPFRGGQDCRGPPDRRGPHPDFPDDFSRPDDFHPDKRFGHRLREFEGRGGPLPQEEKWRRGGP    981 - 1050
GPPFPPDHREFSEGDGRGAARGPPGAWEGRRPGDERFPRDPEDPRFRGRREESFRRGAPPRHEGRAPPRG   1051 - 1120
RDGFPGPEDFGPEENFDASEEAARGRDLRGRGRGTPRGGRKGLLPTPDEFPRFEGGRKPDSWDGNREPGP   1121 - 1190
GHEHFRDTPRPDHPPHDGHSPASRERSSSLQGMDMASLPPRKRPWHDGPGTSEHREMEAPGGPSEDRGGK   1191 - 1260
GRGGPGPAQRVPKSGRSSSLDGEHHDGYHRDEPFGGPPGSGTPSRGGRSGSNWGRGSNMNSGPPRRGASR   1261 - 1330
GGGRGR                                                                   1331 - 1336
//

Text Mined References (31)

PMID Year Title
25301781 2014 Reconstitution of CPSF active in polyadenylation: recognition of the polyadenylation signal by WDR33.
25301780 2014 CPSF30 and Wdr33 directly bind to AAUAAA in mammalian mRNA 3' processing.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...