Property Summary

NCBI Gene PubMed Count 15
Grant Count 50
R01 Count 17
Funding $8,508,166.91
PubMed Score 414.85
PubTator Score 64.16

Knowledge Summary

Patent

No data available

 GO Function (1)

Gene RIF (7)

PMID Text
25771685 these results reveal a novel function of postsynaptic endophilin A1 in spine morphogenesis, stabilization and synaptic function through the regulation of p140Cap
25554419 these findings suggest that miR-374a functions as a candidate oncogene in GC by directly targeting SRCIN1
24456795 Findings indicate the role of miR-150 as an oncogene in lung cancer through the inhibition of SRC kinase signalling inhibitor 1 (SRCIN1) translation.
23383002 p140Cap phosphorylation sites and binding to Csk and Abl kinase
20453886 p140Cap immobilizes E-cadherin at the cell membrane and inhibits EGFR and Erk1/2 signalling, blocking scatter and proliferation of cancer cells.
18475297 Expression correlated significantly with unfavourable overall survival, suggesting that SNIP/p140Cap may be a useful diagnostic and prognostic marker, aas well as therapeutic target, in breast cancer.
17525734 provides the first evidence that p140Cap is a novel negative regulator of tumour growth

AA Sequence

MRGAWVHLHSGAASSLRPCRCGAGAAPKSSPRSPGGRRGDGSSDSEGGVSFAGVLFLQFGEETRRVHITH      1 - 70
EVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVFYELEDVRDIQDRSIIKIYRKEPLYAAFP     71 - 140
GSHLTNGDLRREMVYASRESSPTRRLNNLSPAPHLASGSPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPP    141 - 210
SYAGSPVHHAAERLGGAPAAQGVSPSPSAILERRDVKPDEDLASKAGGMVLVKGEGLYADPYGLLHEGRL    211 - 280
SLAAAAGDPFAYPGAGGLYKRGSVRSLSTYSAAALQSDLEDSLYKAAGGGGPLYGDGYGFRLPPSSPQKL    281 - 350
ADVAAPPGGPPPPHSPYSGPPSRGSPVRQSFRKDSGSSSVFAESPGGKTRSAGSASTAGAPPSELFPGPG    351 - 420
ERSLVGFGPPVPAKDTETRERMEAMEKQIASLTGLVQSALLRGSEPETPSEKIEGSNGAATPSAPCGSGG    421 - 490
RSSGATPVSGPPPPSASSTPAGQPTAVSRLQMQLHLRGLQNSASDLRGQLQQLRKLQLQNQESVRALLKR    491 - 560
TEAELSMRVSEAARRQEDPLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVSHNHRLVPGPE    561 - 630
LEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRRQ    631 - 700
VDEGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPG    701 - 770
KRSVDKAVSVEAAERDWEEKRAALTQYSAKDINRLLEETQAELLKAIPDLDCASKAHPGPAPTPDHKPPK    771 - 840
APHGQKAAPRTEPSGRRGSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGLTTTRTGEVVVTSKKDSAFI    841 - 910
KKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASR    911 - 980
LKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARN    981 - 1050
SSISF                                                                    1051 - 1055
//

Text Mined References (18)

PMID Year Title
25771685 2015 Endophilin A1 regulates dendritic spine morphogenesis and stability through interaction with p140Cap.
25554419 2015 miR-374a promotes cell proliferation, migration and invasion by targeting SRCIN1 in gastric cancer.
24456795 2014 miR-150 promotes the proliferation and migration of lung cancer cells by targeting SRC kinase signalling inhibitor 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23383002 2013 Mapping of p140Cap phosphorylation sites: the EPLYA and EGLYA motifs have a key role in tyrosine phosphorylation and Csk binding, and are substrates of the Abl kinase.
20453886 2010 p140Cap dual regulation of E-cadherin/EGFR cross-talk and Ras signalling in tumour cell scatter and proliferation.
19146815 2009 Dynamic microtubules regulate dendritic spine morphology and synaptic plasticity.
18662323 2008 Characterization of a multidomain adaptor protein, p140Cap, as part of a pre-synaptic complex.
18475297 2008 SNIP/p140Cap mRNA expression is an unfavourable prognostic factor in breast cancer and is not expressed in normal breast tissue.
17525734 2007 p140Cap protein suppresses tumour cell properties, regulating Csk and Src kinase activity.
More...