Property Summary

NCBI Gene PubMed Count 20
PubMed Score 451.32
PubTator Score 64.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 1.2e-06
astrocytic glioma -1.400 2.3e-02
Astrocytoma, Pilocytic -2.100 5.4e-12
atypical teratoid / rhabdoid tumor -2.400 1.0e-08
ependymoma -1.600 1.6e-02
glioblastoma -2.200 1.1e-10
group 3 medulloblastoma -1.100 2.8e-03
medulloblastoma, large-cell -2.100 5.3e-04
oligodendroglioma -1.300 3.4e-02
osteosarcoma -1.030 5.7e-03
Pick disease -1.100 3.4e-02
pituitary cancer 1.400 4.6e-05
primitive neuroectodermal tumor -1.400 2.4e-02
subependymal giant cell astrocytoma -3.365 1.8e-02

Gene RIF (12)

AA Sequence

MRGAWVHLHSGAASSLRPCRCGAGAAPKSSPRSPGGRRGDGSSDSEGGVSFAGVLFLQFGEETRRVHITH      1 - 70
EVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVFYELEDVRDIQDRSIIKIYRKEPLYAAFP     71 - 140
GSHLTNGDLRREMVYASRESSPTRRLNNLSPAPHLASGSPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPP    141 - 210
SYAGSPVHHAAERLGGAPAAQGVSPSPSAILERRDVKPDEDLASKAGGMVLVKGEGLYADPYGLLHEGRL    211 - 280
SLAAAAGDPFAYPGAGGLYKRGSVRSLSTYSAAALQSDLEDSLYKAAGGGGPLYGDGYGFRLPPSSPQKL    281 - 350
ADVAAPPGGPPPPHSPYSGPPSRGSPVRQSFRKDSGSSSVFAESPGGKTRSAGSASTAGAPPSELFPGPG    351 - 420
ERSLVGFGPPVPAKDTETRERMEAMEKQIASLTGLVQSALLRGSEPETPSEKIEGSNGAATPSAPCGSGG    421 - 490
RSSGATPVSGPPPPSASSTPAGQPTAVSRLQMQLHLRGLQNSASDLRGQLQQLRKLQLQNQESVRALLKR    491 - 560
TEAELSMRVSEAARRQEDPLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVSHNHRLVPGPE    561 - 630
LEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRRQ    631 - 700
VDEGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPG    701 - 770
KRSVDKAVSVEAAERDWEEKRAALTQYSAKDINRLLEETQAELLKAIPDLDCASKAHPGPAPTPDHKPPK    771 - 840
APHGQKAAPRTEPSGRRGSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGLTTTRTGEVVVTSKKDSAFI    841 - 910
KKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASR    911 - 980
LKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARN    981 - 1050
SSISF                                                                    1051 - 1055
//

Text Mined References (23)

PMID Year Title