Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.74
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.832 1.6e-02
aldosterone-producing adenoma -1.464 3.7e-02
astrocytic glioma -1.800 6.3e-03
ependymoma -2.400 3.5e-03
group 4 medulloblastoma -2.600 1.1e-05
medulloblastoma, large-cell -1.800 1.2e-02
oligodendroglioma -2.100 3.7e-03
osteosarcoma 1.664 9.3e-04
primitive neuroectodermal tumor -2.700 2.5e-04

AA Sequence

MSVSGKKEFDVKQILRLRWRWFSHPFQGSTNTGSCLQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVH      1 - 70
HNILAPVPGPAPAHQRAVQNLQQHNLIVHFQANEDTPKSVPEKNLFKEACEKRAQDLEMMADDNIEDSTA     71 - 140
RLDTQHSEDMNATRSEEQFHVINHAEQTLRKMENYLKEKQLCDVLLIAGHLRIPAHRLVLSAVSDYFAAM    141 - 210
FTNDVLEAKQEEVRMEGVDPNALNSLVQYAYTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH    211 - 280
PSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEVIKNQEFLLLPANEISKLLCSDDINVPDEETIFHALM    281 - 350
QWVGHDVQNRQGELGMLLSYIRLPLLPPQLLADLETSSMFTGDLECQKLLMEAMKYHLLPERRSMMQSPR    351 - 420
TKPRKSTVGALYAVGGMDAMKGTTTIEKYDLRTNSWLHIGTMNGRRLQFGVAVIDNKLYVVGGRDGLKTL    421 - 490
NTVECFNPVGKIWTVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTVERWDPEGRQWNYVASMSTPR    491 - 560
STVGVVALNNKLYAIGGRDGSSCLKSMEYFDPHTNKWSLCAPMSKRRGGVGVATYNGFLYVVGGHDAPAS    561 - 630
NHCSRLSDCVERYDPKGDSWSTVAPLSVPRDAVAVCPLGDKLYVVGGYDGHTYLNTVESYDAQRNEWKEE    631 - 700
VPVNIGRAGACVVVVKLP                                                        701 - 718
//

Text Mined References (13)

PMID Year Title