Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.57
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 0.006
ependymoma -2.400 0.003
oligodendroglioma -2.100 0.004
osteosarcoma 1.664 0.001
medulloblastoma, large-cell -1.800 0.012
primitive neuroectodermal tumor -2.700 0.000
adrenocortical carcinoma -3.272 0.000
group 4 medulloblastoma -2.600 0.000
aldosterone-producing adenoma -1.464 0.037

AA Sequence

MSVSGKKEFDVKQILRLRWRWFSHPFQGSTNTGSCLQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVH      1 - 70
HNILAPVPGPAPAHQRAVQNLQQHNLIVHFQANEDTPKSVPEKNLFKEACEKRAQDLEMMADDNIEDSTA     71 - 140
RLDTQHSEDMNATRSEEQFHVINHAEQTLRKMENYLKEKQLCDVLLIAGHLRIPAHRLVLSAVSDYFAAM    141 - 210
FTNDVLEAKQEEVRMEGVDPNALNSLVQYAYTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH    211 - 280
PSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEVIKNQEFLLLPANEISKLLCSDDINVPDEETIFHALM    281 - 350
QWVGHDVQNRQGELGMLLSYIRLPLLPPQLLADLETSSMFTGDLECQKLLMEAMKYHLLPERRSMMQSPR    351 - 420
TKPRKSTVGALYAVGGMDAMKGTTTIEKYDLRTNSWLHIGTMNGRRLQFGVAVIDNKLYVVGGRDGLKTL    421 - 490
NTVECFNPVGKIWTVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTVERWDPEGRQWNYVASMSTPR    491 - 560
STVGVVALNNKLYAIGGRDGSSCLKSMEYFDPHTNKWSLCAPMSKRRGGVGVATYNGFLYVVGGHDAPAS    561 - 630
NHCSRLSDCVERYDPKGDSWSTVAPLSVPRDAVAVCPLGDKLYVVGGYDGHTYLNTVESYDAQRNEWKEE    631 - 700
VPVNIGRAGACVVVVKLP                                                        701 - 718
//

Text Mined References (14)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18039948 2008 Genomic imbalances associated with mullerian aplasia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...