Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.36
PubTator Score 0.96

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.8e-04
invasive ductal carcinoma 2951 9.2e-03
Disease Target Count Z-score Confidence
Mastitis 48 3.484 1.7


  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma 1.100 9.2e-03
osteosarcoma -1.476 5.8e-04

AA Sequence

DDPRVIFENTRKEMSFLRVLIQHLDTSFMEGVL                                        1051 - 1083

Text Mined References (16)

PMID Year Title