Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.56
PubTator Score 2.53

Knowledge Summary

Patent (738)

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 9.4e-06
glioblastoma 5792 3.3e-04
atypical teratoid / rhabdoid tumor 5112 1.2e-03
osteosarcoma 7950 3.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Craniosynostosis 74 3.148 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
Breast cancer 1.700 9.4e-06
glioblastoma 1.400 3.3e-04
osteosarcoma 1.278 3.1e-03

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLFLLFYSFWLCC      1 - 70
RRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA     71 - 140
VGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRW    141 - 210
LGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTK    211 - 280
MVEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVL    281 - 350
NGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPD    351 - 420
EDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNANFQNPRCENTP    421 - 490
LIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH                                         491 - 523
//

Text Mined References (18)

PMID Year Title