Property Summary

NCBI Gene PubMed Count 10
PubMed Score 33.64
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma -1.300 0.005
medulloblastoma, large-cell -1.200 0.001
primary pancreatic ductal adenocarcinoma 1.006 0.021
interstitial cystitis -1.200 0.000
group 4 medulloblastoma 1.100 0.008
pilocytic astrocytoma 1.200 0.000
invasive ductal carcinoma -1.219 0.003
ovarian cancer 1.200 0.012

Synonym

Accession Q9C0F3 Q658I9
Symbols ZNF
Zfp46

Gene

Gene RIF (2)

PMID Text
18187620 Knockdown of zinc finger protein 436 (ZNF436) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17089209 ZNF436 is a member of the zinc finger transcription factor family and may act as a negative regulator in gene transcription mediated by the MAPK signaling pathways.

AA Sequence

MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQENYGNVVSLDFEIRSENEVNPKQEIS      1 - 70
EDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHIC     71 - 140
SHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRSSHLI    141 - 210
QHQTIHTGEKPHKCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYEC    211 - 280
NECGRGFSERSDLIKHYRVHTGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLV    281 - 350
QHQRTHTGEKPYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC    351 - 420
VQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD                        421 - 470
//

Text Mined References (12)

PMID Year Title
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17089209 2006 A novel zinc-finger protein ZNF436 suppresses transcriptional activities of AP-1 and SRE.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
More...