Property Summary

NCBI Gene PubMed Count 10
PubMed Score 36.23
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.8e-04
group 4 medulloblastoma 1.100 8.3e-03
interstitial cystitis -1.100 1.5e-03
invasive ductal carcinoma -1.196 1.8e-03
medulloblastoma, large-cell -1.200 1.2e-03
oligodendroglioma -1.300 4.8e-03
ovarian cancer 1.200 1.2e-02
primary pancreatic ductal adenocarcinoma 1.006 2.1e-02

Gene RIF (2)

AA Sequence

MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQENYGNVVSLDFEIRSENEVNPKQEIS      1 - 70
EDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHIC     71 - 140
SHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRSSHLI    141 - 210
QHQTIHTGEKPHKCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYEC    211 - 280
NECGRGFSERSDLIKHYRVHTGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLV    281 - 350
QHQRTHTGEKPYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC    351 - 420
VQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD                        421 - 470
//

Text Mined References (13)

PMID Year Title