Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $17,505.5
PubMed Score 11.07
PubTator Score 6.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9C0E8 B7ZLA8 Q2M2V8 Q2YD99 Q658W8 Q8N5V9 Q96MS5
Symbols Ul
LNP
LNP1
KIAA1715
ulnaless

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (3)

PMID Text
25548161 used live cell imaging to show that mammalian Lnp1 affects endoplasmic reticulum junction mobility and hence network dynamics
24223779 Protein N-myristoylation plays a critical role in the endoplasmic reticulum morphological change induced by overexpression of protein Lunapark.
22729086 Propose that Lnp1p and Sey1p act antagonistically to balance endoplasmic reticular polygonal network formation.

AA Sequence

MGGLFSRWRTKPSTVEVLESIDKEIQALEEFREKNQRLQKLWVGRLILYSSVLYLFTCLIVYLWYLPDEF      1 - 70
TARLAMTLPFFAFPLIIWSIRTVIIFFFSKRTERNNEALDDLKSQRKKILEEVMEKETYKTAKLILERFD     71 - 140
PDSKKAKECEPPSAGAAVTARPGQEIRQRTAAQRNLSPTPASPNQGPPPQVPVSPGPPKDSSAPGGPPER    141 - 210
TVTPALSSNVLPRHLGSPATSVPGMGLHPPGPPLARPILPRERGALDRIVEYLVGDGPQNRYALICQQCF    211 - 280
SHNGMALKEEFEYIAFRCAYCFFLNPARKTRPQAPRLPEFSFEKRQVVEGSSSVGPLPSGSVLSSDNQFN    281 - 350
EESLEHDVLDDNTEQTDDKIPATEQTNQVIEKASDSEEPEEKQETENEEASVIETNSTVPGADSIPDPEL    351 - 420
SGESLTAE                                                                  421 - 428
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25548161 2015 Lunapark stabilizes nascent three-way junctions in the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223779 2013 Protein N-myristoylation plays a critical role in the endoplasmic reticulum morphological change induced by overexpression of protein Lunapark, an integral membrane protein of the endoplasmic reticulum.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22729086 2012 ER network formation requires a balance of the dynamin-like GTPase Sey1p and the Lunapark family member Lnp1p.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
21269460 2011 Initial characterization of the human central proteome.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
More...