Property Summary

NCBI Gene PubMed Count 17
Grant Count 26
R01 Count 19
Funding $1,916,572.44
PubMed Score 39.64
PubTator Score 18.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.071 0.031
medulloblastoma, large-cell 1.800 0.000
limb girdle muscular dystrophy 2A -1.142 0.000
group 3 medulloblastoma 1.600 0.000
Pick disease -1.200 0.000
progressive supranuclear palsy -1.100 0.008

Gene RIF (8)

PMID Text
26293807 XPO4 copy number variation duplication was associated with histological severity of non-alcoholic fatty liver disease.
25911113 Knockdown of exportins 4, 5, and 7 altered thyroid hormone receptor shuttling dynamics, and when exportins 5 and 7 were overexpressed, TR distribution shifted toward the cytosol.
24597692 Methylation status of XPO4 in peripheral blood mononuclear cells (PBMCs) tended to be a noninvasive biomarker to predict hepatocellular carcinoma (HCC) and the progression of hepatitis B virus (HBV)infection.
22190034 HIV-1 Vpu is identified to have a physical interaction with exportin 4 (XPO4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21991335 These results demonstrate that Exp4 acts as a Sox9 co-regulator that directly regulates binding of Sox9 to its target genes.
21332550 Data suggest that XPO4 could be involved in the progression of human hepatocellular carcinoma.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16449645 A short peptide representing the minimal interaction domain in Smad3 effectively competes with Smad3 association to exportin 4 and blocks nuclear export of Smad3 in vivo.

AA Sequence

MMAAALGPPEVIAQLENAAKVLMAPPSMVNNEQRQHAEHIFLSFRKSKSPFAVCKHILETSKVDYVLFQA      1 - 70
ATAIMEAVVREWILLEKGSIESLRTFLLTYVLQRPNLQKYVREQILLAVAVIVKRGSLDKSIDCKSIFHE     71 - 140
VSQLISSGNPTVQTLACSILTALLSEFSSSSKTSNIGLSMEFHGNCKRVFQEEDLRQIFMLTVEVLQEFS    141 - 210
RRENLNAQMSSVFQRYLALANQVLSWNFLPPNLGRHYIAMFESSQNVLLKPTESWRETLLDSRVMELFFT    211 - 280
VHRKIREDSDMAQDSLQCLAQLASLHGPIFPDEGSQVDYLAHFIEGLLNTINGIEIEDSEAVGISSIISN    281 - 350
LITVFPRNVLTAIPSELFSSFVNCLTHLTCSFGRSAALEEVLDKDDMVYMEAYDKLLESWLTLVQDDKHF    351 - 420
HKGFFTQHAVQVFNSYIQCHLAAPDGTRNLTANGVASREEEEISELQEDDRDQFSDQLASVGMLGRIAAE    421 - 490
HCIPLLTSLLEERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIHWLILVTGYLLADDTQGETPL    491 - 560
IPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNRTDSVIRLLSAILRVSEVESRAIRADLTHLL    561 - 630
SPQMGKDIVWFLKRWAKTYLLVDEKLYDQISLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLA    631 - 700
NDTVQLLVTLVERRERANLVIQCENWWNLAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQ    701 - 770
YWTEVLQPLQQRFLRVINQENFQQMCQQEEVKQEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIG    771 - 840
LMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQD    841 - 910
LLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQY    911 - 980
YKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLAT    981 - 1050
RHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASS   1051 - 1120
TPPTLDRKQKMAFLKSLEEFMANVGGLLCVK                                          1121 - 1151
//

Text Mined References (25)

PMID Year Title
26293807 2015 Copy number variation in exportin-4 (XPO4) gene and its association with histological severity of non-alcoholic fatty liver disease.
25911113 2015 Multiple exportins influence thyroid hormone receptor localization.
24597692 2014 Exportin 4 gene expression and DNA promoter methylation status in chronic hepatitis B virus infection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21991335 2011 Exportin 4 interacts with Sox9 through the HMG Box and inhibits the DNA binding of Sox9.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21332550 2011 Decreased expression of XPO4 is associated with poor prognosis in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...