Property Summary

NCBI Gene PubMed Count 12
PubMed Score 98.32
PubTator Score 27.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.246 1.2e-02
adult high grade glioma -1.600 4.5e-06
Astrocytoma, Pilocytic -1.100 3.6e-06
Breast cancer 1.200 2.8e-09
breast carcinoma 1.300 1.0e-04
ductal carcinoma in situ 2.000 3.2e-04
ependymoma -1.200 8.9e-03
glioblastoma -1.300 6.4e-06
intraductal papillary-mucinous neoplasm ... 1.500 1.4e-02
invasive ductal carcinoma 2.900 1.4e-04
lung adenocarcinoma 1.100 1.4e-07
lung carcinoma 1.300 4.3e-18
medulloblastoma -1.100 2.5e-05
non-small cell lung cancer 2.393 9.1e-24
osteosarcoma 1.818 3.9e-05
ovarian cancer 1.600 2.3e-04
pancreatic ductal adenocarcinoma liver m... -1.153 7.7e-03
Pick disease -1.200 6.6e-03
subependymal giant cell astrocytoma -1.111 1.9e-02

Gene RIF (3)

AA Sequence

MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFLLVVFNFLLMAY      1 - 70
FDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTV     71 - 140
YSIFGRGSTGVSVFVLYLLLWVVLFSFILSHWEKYNTGILFLPWGYDISQVTISFVYIVTAVVGVEAWYE    141 - 210
PFLFNFLYRDLFTAMIIGCALCVTLPMSLLNFFRSYKNNTLKLNSVYEAMVPLFSPCLLFILSTAWILWS    211 - 280
PSDILELHPRVFYFMVGTAFANSTCQLIVCQMSSTRCPTLNWLLVPLFLVVLVVNLGVASYVESILLYTL    281 - 350
TTAFTLAHIHYGVRVVKQLSSHFQIYPFSLRKPNSDULGMEEKNIGL                           351 - 397
//

Text Mined References (15)

PMID Year Title