Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
R01 Count 1
Funding $64,335.5
PubMed Score 95.44
PubTator Score 27.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q9C0D9 Q63ZE3 hEPT1
Symbols EPT1
SELI
SEPI

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (1)

PMID Text
18665829 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFLLVVFNFLLMAY      1 - 70
FDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTV     71 - 140
YSIFGRGSTGVSVFVLYLLLWVVLFSFILSHWEKYNTGILFLPWGYDISQVTISFVYIVTAVVGVEAWYE    141 - 210
PFLFNFLYRDLFTAMIIGCALCVTLPMSLLNFFRSYKNNTLKLNSVYEAMVPLFSPCLLFILSTAWILWS    211 - 280
PSDILELHPRVFYFMVGTAFANSTCQLIVCQMSSTRCPTLNWLLVPLFLVVLVVNLGVASYVESILLYTL    281 - 350
TTAFTLAHIHYGVRVVKQLSSHFQIYPFSLRKPNSDULGMEEKNIGL                           351 - 397
//

Text Mined References (12)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18665829 2008 l-selectin gene polymorphisms and complications of sickle cell disease.
17132865 2007 Identification and characterization of human ethanolaminephosphotransferase1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12775843 2003 Characterization of mammalian selenoproteomes.
More...