Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.11
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 7.44777223687653E-4
astrocytic glioma 2241 0.00362003723932434
osteosarcoma 7933 0.0414110774040741
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.041950051972614
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gout 93 3.503 1.8
Cardiovascular system disease 194 0.0 2.0
Osteoporosis 259 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.400 0.004
oligodendroglioma -1.700 0.001
osteosarcoma -1.094 0.041
intraductal papillary-mucinous carcinoma... -1.500 0.042

Synonym

Accession Q9C0D4 Q96LN8
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus EggNOG Inparanoid

Gene RIF (2)

PMID Text
26345926 SLC2A9 and ZNF518B polymorphisms correlate with gout-related metabolic indices in Chinese Tibetan populations
25591661 CLNK and ZNF518B SNPs may have potential as diagnostic and prognostic marker for Chinese gout patients.

AA Sequence

MKDIGQQLYTTHLNGGHNSLTMSPKQPDANGAPRPNRQEAQTLLYQGSEAEAAMMTIATCAKCKSVHKIS      1 - 70
LQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSSVNSKFKVRNFKPGKYYCDKC     71 - 140
RFSTKDPLQYKKHTLQHEEIKFICSHCSYISYTKGEFQRHLVKHTGIFPYQCEYCDYGAIRNDYIVKHTK    141 - 210
RVHERAGAKRPVKAVAKLEPKRTGTSKQNPELLKASNPRTTFQNKWSDQLSGFSLHANKDKMHNIMLLPE    211 - 280
PKEYQKDVVCIPNKMTLSEPNEVNLFENKNVEVEVLSPAKEPVQPGMPLTVVAPAELVVPANCLAQLIDV    281 - 350
KVVNGTQQLVLKLFPLEENNCLEAGRDNGGNSERMVKEKGSNEQEKVLSAEKTKSLTVDGNVGKLVGIDS    351 - 420
FQPSVQKQLKNVKWVRSYDFIMPNSSVHNNGKSFINSETIEDFQKKNNLYPHRTAFPSVALKGHSLASVF    421 - 490
KNSVLRSLGAASNPFPYKAAVCFAESGRNLHSSSQQLLPFAASPATCSFSGEKGLLPVSENDLESTSKVN    491 - 560
IPVKVVSSNRKQEDNQTEEHKAVSTVGQISSQHKSEYLHINITGEDRSQQPGDKPLELKNSERTNNTNDG    561 - 630
PVISSVFSLSSGSENVPEGIKWNSSTSKIKSIELLRRKIAQLIESCGKPSSLASNSAHRRSVGQASKGTS    631 - 700
KATSEGIQEINVSLTGLGHSTGTLQKPPNDGGITGNRQLTHQQIYPHFADGSNRKTKSRVARKAHVATPV    701 - 770
LIPKGAVLRVLNSSENAHIIEATCEAPVSIPCSERQLIKPVPFCPVRQADSDLQPLRSERGPIDMSPNIE    771 - 840
TPLRPKLRKESAVCSTIHRKTGLLYGQQGSSELNKQGRLLSRSLSISRNKTKQVHLSRKKNKIQAEPSRC    841 - 910
LKDPSIFQVARQLRLIAAKPDQLIKCPRRNQPVIVLNHPDVDSPEVTNVMKVINKYKGNVLKVVLSERTR    911 - 980
CQLGIRRHHVRLTYQNAEEASQIKRQMMLKMKLKKVHKNNYQVVDSLPDDSSQCVFKCWFCGRLYEDQEE    981 - 1050
WMSHGQRHLIEATRDWDVLSSKGK                                                 1051 - 1074
//

Text Mined References (6)

PMID Year Title
26345926 2015 SLC2A9 and ZNF518B polymorphisms correlate with gout-related metabolic indices in Chinese Tibetan populations.
25591661 2015 Genetic variations in the CLNK gene and ZNF518B gene are associated with gout in case-control sample sets.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.