Property Summary

NCBI Gene PubMed Count 60
PubMed Score 63.15
PubTator Score 37.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Common Migraine 7
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-02
astrocytic glioma -2.100 1.2e-02
Astrocytoma, Pilocytic -1.200 2.9e-04
atypical teratoid / rhabdoid tumor -1.800 5.7e-05
gastric cancer -1.300 4.5e-03
glioblastoma -1.100 1.3e-04
hepatocellular carcinoma -1.600 2.1e-05
intraductal papillary-mucinous adenoma (... -1.300 3.2e-04
intraductal papillary-mucinous carcinoma... -1.300 1.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 3.8e-03
lung adenocarcinoma -1.300 8.3e-15
lung cancer -2.800 3.4e-04
malignant mesothelioma -4.800 3.5e-09
medulloblastoma -1.400 9.3e-03
medulloblastoma, large-cell -2.900 1.6e-03
non-small cell lung cancer -1.675 1.4e-23
oligodendroglioma -1.200 1.3e-12
osteosarcoma -3.502 7.1e-08
ovarian cancer -1.300 4.6e-06
Pick disease 1.200 2.1e-02
posterior fossa group A ependymoma -1.200 2.7e-04
primary Sjogren syndrome 1.100 1.4e-03
primitive neuroectodermal tumor -1.600 7.6e-03
progressive supranuclear palsy 1.200 3.1e-02
subependymal giant cell astrocytoma -1.139 1.3e-02
tuberculosis -2.200 2.8e-04
ulcerative colitis 1.100 1.7e-03

Gene RIF (18)

AA Sequence

MDYPKMDYFLDVESAHRLLDVESAQRFFYSQGAQARRATLLLPPTLMAASSEDDIDRRPIRRVRSKSDTP      1 - 70
YLAEARISFNLGAAEEVERLAAMRSDSLVPGTHTPPIRRRSKFANLGRIFKPWKWRKKKSEKFKHTSAAL     71 - 140
ERKISMRQSREELIKRGVLKEIYDKDGELSISNEEDSLENGQSLSSSQLSLPALSEMEPVPMPRDPCSYE    141 - 210
VLQPSDIMDGPDPGAPVKLPCLPVKLSPPLPPKKVMICMPVGGPDLSLVSYTAQKSGQQGVAQHHHTVLP    211 - 280
SQIQHQLQYGSHGQHLPSTTGSLPMHPSGCRMIDELNKTLAMTMQRLESSEQRVPCSTSYHSSGLHSGDG    281 - 350
VTKAGPMGLPEIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSSLAMKVCR    351 - 420
KDSLAIKLSNRPSKRELEEKNILPRQTDEERLELRQQIGTKLTRRLSQRPTAEELEQRNILKPRNEQEEQ    421 - 490
EEKREIKRRLTRKLSQRPTVEELRERKILIRFSDYVEVADAQDYDRRADKPWTRLTAADKAAIRKELNEF    491 - 560
KSTEMEVHELSRHLTRFHRP                                                      561 - 580
//

Text Mined References (62)

PMID Year Title