Property Summary

NCBI Gene PubMed Count 30
Grant Count 3
R01 Count 2
Funding $164,062.31
PubMed Score 37.60
PubTator Score 27.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.470 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9C0C7 A6XN33 D3DQP8 G3V193 Q86XD6 Q9H8Z0 Q9NXE7
Symbols DCAF3
WDR94

Gene

Gene RIF (15)

PMID Text
26763392 Ambra1 is a crucial regulator of autophagy and apoptosis in ovarian cancer cells subject to cisplatin to maintain the balance between autophagy and apoptosis. Ambra1-targeting inhibition might sensitize ovarian cancer cells to chemotherapy.
26423274 An increased expression of AMBRA1 and SQSTM1.
26086269 Ambra1 mRNA translocation to P-bodies and translational suppression correlated with increased cell death.
25803737 Both AMBRA1 and BECLIN 1 affect c-Myc regulation, but through two different pathways.
25499913 AMBRA1 interacts with cullin E3 ubiquitin ligases to regulate autophagy dynamics
25438055 a de-regulation of c-Myc correlates with increased tumorigenesis in AMBRA1-defective systems, thus supporting a role for AMBRA1 as a haploinsufficient tumour suppressor gene.
24587252 Ambra1 is a crucial regulator of autophagy and apoptosis in colorectal cancer cells
23551272 A schizophrenia-related risk variant in AMBRA1 (rs11819869) is involved in various aspects of impulsivity, and this involvement occurs on a behavioral as well as an imaging genetics level.
23524951 findings show under non-autophagic conditions, mTOR inhibits AMBRA1 by phosphorylation, whereas on autophagy induction, AMBRA1 is dephosphorylated; in this condition, AMBRA1, interacting with TRAF6, supports ULK1 ubiquitylation by LYS-63-linked chains, and its stabilization, self-association and function
23429496 Data suggest that activated autophagy is associated with the progression of pancreatic ductal adenocarcinoma and that the overexpression of autophagy-related proteins Atg5, Ambra1, beclin-1, LC3B and Bif-1 is significantly correlated with poor outcome.
More...

AA Sequence

MKVVPEKNAVRILWGRERGARAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLAFSPDRTLLAS      1 - 70
THVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLHGGSESWFTDSNNAI     71 - 140
ASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERVRLVRFDPLGHYLLTAIVNPSNQQGDDE    141 - 210
PEIPIDGTELSHYRQRALLQSQPVRRTPLLHNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTE    211 - 280
RPRTSAYIRLRQRVSYPTAECCQHLGILCLCSRCSGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFH    281 - 350
PPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHREIAPGLTGSEWT    351 - 420
RTVLSLNSRSEAESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPASGLATESDGGNGSSQN    421 - 490
NSGSIRHELQCDLRRFFLEYDRLQELDQSLSGEAPQTQQAQEMLNNNIESERPGPSHQPTPHSSENNSNL    491 - 560
SRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWQVPSSFESVPSSGSQLPPLERTEGQTPSSS    561 - 630
RLELSSSASPQEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLIS    631 - 700
LSRYDGAGSREHPIYPDPARLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVE    701 - 770
GTDLEFEDFEDNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLA    771 - 840
GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISADGQLLAAFIPS    841 - 910
SQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFR    911 - 980
LQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPEALNSGVEYYWD    981 - 1050
QLNETVFTVHSNSRSSERPGTSRATWRTDRDMGLMNAIGLQPRNPATSVTSQGTQTLALQLQNAETQTER   1051 - 1120
EVPEPGTAASGPGEGEGSEYGASGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHR   1121 - 1190
SSQTGTEPGAAHTSSPQPSTSRGLLPEAGQLAERGLSPRTASWDQPGTPGREPTQPTLPSSSPVPIPVSL   1191 - 1260
PSAEGPTLHCELTNNNHLLDGGSSRGDAAGPRGEPRNR                                   1261 - 1298
//

Text Mined References (40)

PMID Year Title
26763392 2016 shRNA-mediated AMBRA1 knockdown reduces the cisplatin-induced autophagy and sensitizes ovarian cancer cells to cisplatin.
26423274 2015 AMBRA1 and SQSTM1 expression pattern in prostate cancer.
26086269 2015 Prolonged Pseudohypoxia Targets Ambra1 mRNA to P-Bodies for Translational Repression.
25803737 2015 AMBRA1 and BECLIN 1 interplay in the crosstalk between autophagy and cell proliferation.
25499913 2014 AMBRA1 interplay with cullin E3 ubiquitin ligases regulates autophagy dynamics.
25438055 2015 AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation.
25215947 2015 AMBRA1 is able to induce mitophagy via LC3 binding, regardless of PARKIN and p62/SQSTM1.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24587252 2014 Ambra1 is an essential regulator of autophagy and apoptosis in SW620 cells: pro-survival role of Ambra1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...