Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 5
Funding $1,269,695.5
PubMed Score 100.50
PubTator Score 15.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (1)

PMID Text
26657846 Since CAD and Erk have significant roles in cell proliferation and cell cycle, CIPC may work as a cell cycle regulator by interacting with these binding proteins.

AA Sequence

MERKNPSRESPRRLSAKVGKGTEMKKVARQLGMAAAESDKDSGFSDGSSECLSSAEQMESEDMLSALGWS      1 - 70
REDRPRQNSKTAKNAFPTLSPMVVMKNVLVKQGSSSSQLQSWTVQPSFEVISAQPQLLFLHPPVPSPVSP     71 - 140
CHTGEKKSDSRNYLPILNSYTKIAPHPGKRGLSLGPEEKGTSGVQKKICTERLGPSLSSSEPTKAGAVPS    141 - 210
SPSTPAPPSAKLAEDSALQGVPSLVAGGSPQTLQPVSSSHVAKAPSLTFASPASPVCASDSTLHGLESNS    211 - 280
PLSPLSANYSSPLWAAEHLCRSPDIFSEQRQSKHRRFQNTLVVLHKSGLLEITLKTKELIRQNQATQVEL    281 - 350
DQLKEQTQLFIEATKSRAPQAWAKLQASLTPGSSNTGSDLEAFSDHPAI                         351 - 399
//

Text Mined References (13)

PMID Year Title
26657846 2016 Versatile function of the circadian protein CIPC as a regulator of Erk activation.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19414601 2009 Roles of CLOCK phosphorylation in suppression of E-box-dependent transcription.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17310242 2007 CIPC is a mammalian circadian clock protein without invertebrate homologues.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...