Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $327,567
PubMed Score 41.64
PubTator Score 26.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 1.500 0.000
osteosarcoma 2.317 0.000
subependymal giant cell astrocytoma -1.080 0.023
ovarian cancer 1.300 0.001

Synonym

Accession Q9C0C4 Q32MJ3 Q7Z5X0
Symbols SEMAF
SEMAI
SEMACL1
M-SEMA-F

Gene

Gene RIF (4)

PMID Text
25605244 Suggest that up-regulation of miR-125b or targeting Sema4C could serve as novel approaches to reverse chemotherapy resistance in breast cancers.
24142719 Data suggest that Erbin can interact with Sema4C, and co-expression of Erbin blocks the process of Sema4C-induced epithelial-mesenchymal transition.
22944267 There is a high expression of Sema4C in esophageal cancer, gastric cancer and rectal cancer, and expression is strongly correlated with lymphatic metastasis.
20959347 High Sema4C is associated with epithelial-mesenchymal transition and renal fibrosis.

AA Sequence

MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTEPTGLLYVGAR      1 - 70
EALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPYNASHLYVCGTYAFQPKCTYV     71 - 140
NMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYLAFWL    141 - 210
NEPHFVGSAYVPESVGSFTGDDDKVYFFFRERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLK    211 - 280
ARLACSAPNWQLYFNQLQAMHTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHE    281 - 350
EAQKWDRYTDPVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF    351 - 420
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQSKKLLFAGSRS    421 - 490
QLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQHVMTSDTSGICNLRGSKKVRP    491 - 560
TPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQPGSFLYDARLQALVVMAAQPRHAGAYHCFSE    561 - 630
EQGARLAAEGYLVAVVAGPSVTLEARAPLENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKA    631 - 700
TERTLVYPLELPKEPTSPPFRPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPL    701 - 770
PSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV           771 - 833
//

Text Mined References (19)

PMID Year Title
25605244 2015 MiR-125b regulates epithelial-mesenchymal transition via targeting Sema4C in paclitaxel-resistant breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24142719 2013 Erbin interacts with Sema4C and inhibits Sema4C-induced epithelial-mesenchymal transition in HK2 cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22944267 2012 [Expression and clinical significance of Sema4C in esophageal cancer, gastric cancer and rectal cancer].
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20959347 2011 Role of Sema4C in TGF-?1-induced mitogen-activated protein kinase activation and epithelial-mesenchymal transition in renal tubular epithelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17498836 2007 Sema4C participates in myogenic differentiation in vivo and in vitro through the p38 MAPK pathway.
More...