Property Summary

NCBI Gene PubMed Count 18
PubMed Score 46.05
PubTator Score 26.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 5.5e-08
malignant mesothelioma 3232 1.2e-06
psoriasis 6694 3.2e-04
ovarian cancer 8520 7.4e-04
subependymal giant cell astrocytoma 2287 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Retinitis pigmentosa 33 4 4.592 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.400 1.2e-06
osteosarcoma 2.317 5.5e-08
ovarian cancer 1.300 7.4e-04
psoriasis 1.500 3.2e-04
subependymal giant cell astrocytoma -1.080 2.3e-02

Pathway (1)

Gene RIF (6)

AA Sequence

MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTEPTGLLYVGAR      1 - 70
EALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPYNASHLYVCGTYAFQPKCTYV     71 - 140
NMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYLAFWL    141 - 210
NEPHFVGSAYVPESVGSFTGDDDKVYFFFRERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLK    211 - 280
ARLACSAPNWQLYFNQLQAMHTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHE    281 - 350
EAQKWDRYTDPVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF    351 - 420
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQSKKLLFAGSRS    421 - 490
QLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQHVMTSDTSGICNLRGSKKVRP    491 - 560
TPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQPGSFLYDARLQALVVMAAQPRHAGAYHCFSE    561 - 630
EQGARLAAEGYLVAVVAGPSVTLEARAPLENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKA    631 - 700
TERTLVYPLELPKEPTSPPFRPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPL    701 - 770
PSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV           771 - 833
//

Text Mined References (21)

PMID Year Title