Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.40
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Influenza 142
Disease Target Count P-value
juvenile dermatomyositis 1189 7.67199115998495E-11
osteosarcoma 7933 4.04501645782606E-7
medulloblastoma, large-cell 6234 1.41116329506263E-6
ovarian cancer 8492 3.30933005378358E-6
systemic lupus erythematosus 172 9.72537055515606E-5
glioblastoma 5572 0.00110893244995046
adult high grade glioma 2148 0.00139196852891464
dermatomyositis 967 0.00188043788758165
medulloblastoma 1524 0.00188975053171695
pituitary cancer 1972 0.00331178061288982
astrocytic glioma 2241 0.00351321516552898
Pick disease 1893 0.00569810550451533

Expression

  Differential Expression (12)

Disease log2 FC p
systemic lupus erythematosus 1.200 0.000
astrocytic glioma -1.100 0.004
osteosarcoma -1.790 0.000
glioblastoma -1.300 0.001
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -2.200 0.000
juvenile dermatomyositis 1.208 0.000
adult high grade glioma -1.200 0.001
Pick disease 1.300 0.006
ovarian cancer 1.900 0.000
pituitary cancer -1.100 0.003
dermatomyositis 1.300 0.002

Synonym

Accession Q9C0B9 B2RPG6 Q8N3S1 Q9NXF6
Symbols C18orf49

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

AA Sequence

MLRMKLPLKPTHPAEPPPEAEEPEADARPGAKAPSRRRRDCRPPPPPPPPAGPSRGPLPPPPPPRGLGPP      1 - 70
VAGGAAAGAGMPGGGGGPSAALREQERVYEWFGLVLGSAQRLEFMCGLLDLCNPLELRFLGSCLEDLARK     71 - 140
DYHYLRDSEAKANGLSDPGPLADFREPAVRSRLIVYLALLGSENREAAGRLHRLLPQVDSVLKSLRAARG    141 - 210
EGSRGGAEDERGEDGDGEQDAEKDGSGPEGGIVEPRVGGGLGSRAQEELLLLFTMASLHPAFSFHQRVTL    211 - 280
REHLERLRAALRGGPEDAEVEVEPCKFAGPRAQNNSAHGDYMQNNESSLIEQAPIPQDGLTVAPHRAQRE    281 - 350
AVHIEKIMLKGVQRKRADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKELSSETFDKTILRALNQ    351 - 420
GSLKREERRHPDLEPILRQLFSSSSQAFLQSQKVHSFFQSISSDSLHSINNLQSSLKTSKILEHLKEDSS    421 - 490
EASSQEEDVLQHAIIHKKHTGKSPIVNNIGTSCSPLDGLTMQYSEQNGIVDWRKQSCTTIQHPEHCVTSA    491 - 560
DQHSAEKRSLSSINKKKGKPQTEKEKIKKTDNRLNSRINGIRLSTPQHAHGGTVKDVNLDIGSGHDTCGE    561 - 630
TSSESYSSPSSPRHDGRESFESEEEKDRDTDSNSEDSGNPSTTRFTGYGSVNQTVTVKPPVQIASLGNEN    631 - 700
GNLLEDPLNSPKYQHISFMPTLHCVMHNGAQKSEVVVPAPKPADGKTIGMLVPSPVAISAIRESANSTPV    701 - 770
GILGPTACTGESEKHLELLASPLPIPSTFLPHSSTPALHLTVQRLKLPPPQGSSESCTVNIPQQPPGSLS    771 - 840
IASPNTAFIPIHNPGSFPGSPVATTDPITKSASQVVGLNQMVPQIEGNTGTVPQPTNVKVVLPAAGLSAA    841 - 910
QPPASYPLPGSPLAAGVLPSQNSSVLSTAATSPQPASAGISQAQATVPPAVPTHTPGPAPSPSPALTHST    911 - 980
AQSDSTSYISAVGNTNANGTVVPPQQMGSGPCGSCGRRCSCGTNGNLQLNSYYYPNPMPGPMYRVPSFFT    981 - 1050
LPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQANYGMQQMAGFGRFYPVYPAPNVVANT   1051 - 1120
SGSGPKKNGNVSCYNCGVSGHYAQDCKQSSMEANQQGTYRLRYAPPLPPSNDTLDSAD               1121 - 1178
//

Text Mined References (17)

PMID Year Title
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16381901 2006 The LIFEdb database in 2006.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...