Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.40
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Influenza, Human 51 0.0 0.0
Disease Target Count
Influenza 142
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-03
astrocytic glioma -1.100 3.5e-03
dermatomyositis 1.300 1.9e-03
glioblastoma -1.300 1.1e-03
group 4 medulloblastoma -1.100 1.6e-02
juvenile dermatomyositis 1.139 1.1e-10
medulloblastoma, large-cell -2.200 1.4e-06
osteosarcoma -1.304 6.6e-03
ovarian cancer -1.200 1.1e-03
Pick disease 1.300 5.7e-03
pituitary cancer -1.100 3.3e-03
Systemic lupus erythematosus 1.200 9.7e-05

AA Sequence

MLRMKLPLKPTHPAEPPPEAEEPEADARPGAKAPSRRRRDCRPPPPPPPPAGPSRGPLPPPPPPRGLGPP      1 - 70
VAGGAAAGAGMPGGGGGPSAALREQERVYEWFGLVLGSAQRLEFMCGLLDLCNPLELRFLGSCLEDLARK     71 - 140
DYHYLRDSEAKANGLSDPGPLADFREPAVRSRLIVYLALLGSENREAAGRLHRLLPQVDSVLKSLRAARG    141 - 210
EGSRGGAEDERGEDGDGEQDAEKDGSGPEGGIVEPRVGGGLGSRAQEELLLLFTMASLHPAFSFHQRVTL    211 - 280
REHLERLRAALRGGPEDAEVEVEPCKFAGPRAQNNSAHGDYMQNNESSLIEQAPIPQDGLTVAPHRAQRE    281 - 350
AVHIEKIMLKGVQRKRADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKELSSETFDKTILRALNQ    351 - 420
GSLKREERRHPDLEPILRQLFSSSSQAFLQSQKVHSFFQSISSDSLHSINNLQSSLKTSKILEHLKEDSS    421 - 490
EASSQEEDVLQHAIIHKKHTGKSPIVNNIGTSCSPLDGLTMQYSEQNGIVDWRKQSCTTIQHPEHCVTSA    491 - 560
DQHSAEKRSLSSINKKKGKPQTEKEKIKKTDNRLNSRINGIRLSTPQHAHGGTVKDVNLDIGSGHDTCGE    561 - 630
TSSESYSSPSSPRHDGRESFESEEEKDRDTDSNSEDSGNPSTTRFTGYGSVNQTVTVKPPVQIASLGNEN    631 - 700
GNLLEDPLNSPKYQHISFMPTLHCVMHNGAQKSEVVVPAPKPADGKTIGMLVPSPVAISAIRESANSTPV    701 - 770
GILGPTACTGESEKHLELLASPLPIPSTFLPHSSTPALHLTVQRLKLPPPQGSSESCTVNIPQQPPGSLS    771 - 840
IASPNTAFIPIHNPGSFPGSPVATTDPITKSASQVVGLNQMVPQIEGNTGTVPQPTNVKVVLPAAGLSAA    841 - 910
QPPASYPLPGSPLAAGVLPSQNSSVLSTAATSPQPASAGISQAQATVPPAVPTHTPGPAPSPSPALTHST    911 - 980
AQSDSTSYISAVGNTNANGTVVPPQQMGSGPCGSCGRRCSCGTNGNLQLNSYYYPNPMPGPMYRVPSFFT    981 - 1050
LPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQANYGMQQMAGFGRFYPVYPAPNVVANT   1051 - 1120
SGSGPKKNGNVSCYNCGVSGHYAQDCKQSSMEANQQGTYRLRYAPPLPPSNDTLDSAD               1121 - 1178
//

Text Mined References (17)

PMID Year Title