Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.12
PubTator Score 5.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 0.00121701134841947
COPD 116 0.00262896065724821
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0075041540761399

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 0.008
COPD -1.100 0.003
ovarian cancer 1.400 0.001

Synonym

Accession Q9C0B5 Q2TGF0 Q6ZMF0 Q8TAK8 Q9H923 Q9UFI7
Symbols DHHC5
ZNF375

Gene

  Ortholog (10)

 CSPA Cell Line (1)

Gene RIF (3)

PMID Text
25573953 Data indicate that DHHC5 has oncogenic capacity and contributes to tumor formation in non-small cell lung cancer.
21820437 ZDHHC5 and SSTR5 are colocalized at the plasma membrane and coexpression of ZDHHC5 increased palmitoylation of SSTR5 whereas knock-down of endogenous ZDHHC5 by siRNAs decreased it.
19801377 Data show that palmitoyl acyltransferases DHHC5, DHHC6, and DHHC8 appear to be S-acylated on three cysteine residues within a novel CCX(7-13)C(S/T) motif downstream of a conserved Asp-His-His-Cys cysteine-rich domain.

AA Sequence

MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLANFSMATFMDP      1 - 70
GIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNC     71 - 140
IGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVL    141 - 210
VARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITV    211 - 280
KIMDNGIQGELRRTKSKGSLEITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPT    281 - 350
MYKYRPGYSSSSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP    351 - 420
LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSPDFESVQAGPE    421 - 490
PDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGR    491 - 560
EEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPEPGPTAPY    561 - 630
LGRSMSYSSQKAQPGVSETEEVALQPLLTPKDEVQLKTTYSKSNGQPKSLGSASPGPGQPPLSSPTRGGV    631 - 700
KKVSGVGGTTYEISV                                                           701 - 715
//

Text Mined References (25)

PMID Year Title
25573953 2015 Systematic siRNA Screen Unmasks NSCLC Growth Dependence by Palmitoyltransferase DHHC5.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22325201 2012 Palmitoylation by DHHC5/8 targets GRIP1 to dendritic endosomes to regulate AMPA-R trafficking.
21820437 2011 Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...