Property Summary

NCBI Gene PubMed Count 562
Grant Count 75
R01 Count 43
Funding $11,642,237.11
PubMed Score 1180.44
PubTator Score 1076.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.000 0.000
inflammatory breast cancer -2.300 0.000
ovarian cancer -2.000 0.000

Synonym

Accession Q9C0B1 A2RUH1 B2RNS0 Q0P676 Q7Z785
Symbols GDFD
ALKBH9
BMIQ14

Gene

FTO

PDB

3LFM   4CXW   4CXX   4CXY   4IDZ   4IE0   4IE4   4IE5   4IE6   4IE7   4QHO   4QKN   4ZS2   4ZS3   5DAB  

 GO Component (2)

Gene RIF (632)

PMID Text
26935496 The young Polish population is characterized by two disparate haplotypes of common FTO gene variants: TCGA (a risk SNP haplotype), and CTAT (a protective haplotype) in terms of body fat distribution.
26908368 Physical activity may modify the genetic effect of FTO on the obesity-related risk in Latino children and adults.
26888713 Individuals carrying the homozygous FTO obesity-predisposing allele may lose more weight through diet/lifestyle interventions than noncarriers. [Review, Meta-analysis]
26852537 Compared with individuals with genotype TT, the examinees with the AA genotype rs9939609 FTO gene was significantly higher BMI, waist circumference, hip circumference, fat mass.
26849546 Obese children carrying the FTO GG and/or the MC4R CC genotype lost more body weight in comparison to non-carriers from a lifestyle intervention.
26772723 importance of determining FTO, 9p21, and 2q36.3 variants as part of the genetic determination of myocardial infarction risk in the Czech male population
26766031 Meta-analysis indicates that SNP rs9939609 within FTO is not associated with major depressive disorder (MDD) in Asian population.
26726774 data suggest that FTO SNPs make differential contributions to obesity risk and support the hypothesis that gender differences in the mechanisms involving these variants may contribute to disease development
26722565 Our results demonstrate that FTO gene has little association in polycystic ovary syndrome development.
26722548 FTO expression may have a vital role in the carcinogenesis of breast cancer
More...

AA Sequence

MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFL      1 - 70
TLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFL     71 - 140
KLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGMGSSYNGQDEVDIKSRAAYNVTLLNFMDPQ    141 - 210
KMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDI    211 - 280
ETPGLAIPLHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVD    281 - 350
NDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE    351 - 420
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLT    421 - 490
DIVSELRGQLLEAKP                                                           491 - 505
//

Text Mined References (570)

PMID Year Title
26935496 The Frequencies of Haplotypes of FTO Gene Variants and Their Association with the Distribution of Body Fat in Non-Obese Poles.
26908368 2016 Physical activity and FTO genotype by physical activity interactive influences on obesity.
26888713 2016 FTO genotype and weight loss in diet and lifestyle interventions: a systematic review and meta-analysis.
26852537 2015 [The study of the peculiarities of metabolism in individuals with rs9939609 polymorphism of FTO gene].
26849546 2015 The Impact of Physical Activity and Dietary Measures on the Biochemical and Anthropometric Parameters in Obese Children. Is There Any Genetic Predisposition?
26772723 2016 Gene variants at FTO, 9p21, and 2q36.3 are age-independently associated with myocardial infarction in Czech men.
26766031 2016 Meta-analysis indicates that SNP rs9939609 within FTO is not associated with major depressive disorder (MDD) in Asian population.
26740239 2016 A patient with a novel homozygous missense mutation in FTO and concomitant nonsense mutation in CETP.
26726774 2016 Gender-Dependent Association of FTO Polymorphisms with Body Mass Index in Mexicans.
26722565 2015 Association of common variants of FTO in women with polycystic ovary syndrome.
More...