Property Summary

NCBI Gene PubMed Count 8
PubMed Score 334.46
PubTator Score 17.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 1.95693567385648E-21
oligodendroglioma 2849 4.25334435579066E-12
glioblastoma 5572 2.34341370746367E-7
Breast cancer 3099 4.89754736357974E-5
posterior fossa group B ependymoma 1530 1.03183484445605E-4
pediatric high grade glioma 2712 1.55338694200675E-4
medulloblastoma, large-cell 6234 4.19090737579768E-4
primitive neuroectodermal tumor 3031 8.61984540954733E-4
group 3 medulloblastoma 2254 9.16159494303241E-4
osteosarcoma 7933 0.00156668836749765
breast carcinoma 1614 0.0137437179816589
Disease Target Count Z-score Confidence
Infertility 163 3.155 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.300 0.000
glioblastoma 1.600 0.000
oligodendroglioma 1.300 0.000
osteosarcoma 1.330 0.002
posterior fossa group B ependymoma 1.500 0.000
group 3 medulloblastoma 2.400 0.001
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.600 0.001
breast carcinoma 1.400 0.014
pediatric high grade glioma 1.600 0.000
Breast cancer -1.100 0.000

Synonym

Accession Q9C0B0
Symbols ZC3H5
UNKEMPT
ZC3HDC5

Gene

UNK

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

AA Sequence

MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYTCFHWHFVNQR      1 - 70
RRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRYHLRYYKTGICIHETDSKGNC     71 - 140
TKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVEGSIEGQSAGAASHAMIEKILSEEPRWQETA    141 - 210
YVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQY    211 - 280
CHTRTEQQFHPEIYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAA    281 - 350
GDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER    351 - 420
EDQVGAEYLKNFKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSSLAATPPSPVG    421 - 490
TSSVPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNSTVPHPGSITIGGSLLQSSAPV    491 - 560
NIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSENTFLGTSASHGSLGLNGMNSSIWEHFASGSF    561 - 630
SPGTSPAFLSGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAR    631 - 700
EQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCL    701 - 770
KCQEQKRAVLPCQHAALCELCAEGSECPICQPGRAHTLQS                                  771 - 810
//

Text Mined References (15)

PMID Year Title
25737280 2015 Control of a neuronal morphology program by an RNA-binding zinc finger protein, Unkempt.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...