Property Summary

NCBI Gene PubMed Count 8
PubMed Score 347.98
PubTator Score 17.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.500 3.7e-03
astrocytoma 1.300 2.0e-21
Breast cancer -1.100 4.9e-05
breast carcinoma 1.400 1.4e-02
ependymoma 1.300 4.3e-06
glioblastoma 1.600 2.3e-07
group 3 medulloblastoma 2.400 9.2e-04
medulloblastoma, large-cell 2.000 4.2e-04
oligodendroglioma 1.300 4.3e-12
osteosarcoma 1.330 1.6e-03
primitive neuroectodermal tumor 1.600 8.6e-04

AA Sequence

MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYTCFHWHFVNQR      1 - 70
RRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRYHLRYYKTGICIHETDSKGNC     71 - 140
TKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVEGSIEGQSAGAASHAMIEKILSEEPRWQETA    141 - 210
YVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQY    211 - 280
CHTRTEQQFHPEIYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAA    281 - 350
GDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER    351 - 420
EDQVGAEYLKNFKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSSLAATPPSPVG    421 - 490
TSSVPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNSTVPHPGSITIGGSLLQSSAPV    491 - 560
NIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSENTFLGTSASHGSLGLNGMNSSIWEHFASGSF    561 - 630
SPGTSPAFLSGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAR    631 - 700
EQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCL    701 - 770
KCQEQKRAVLPCQHAALCELCAEGSECPICQPGRAHTLQS                                  771 - 810
//

Text Mined References (15)

PMID Year Title