Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 3
Funding $511,236.49
PubMed Score 0.00
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.045
ependymoma -2.900 0.000
glioblastoma -2.100 0.000
group 3 medulloblastoma -2.400 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.100 0.000
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -3.050 0.003
Pick disease -1.100 0.024
progressive supranuclear palsy -1.400 0.006
psoriasis -1.200 0.000

Gene RIF (5)

PMID Text
24223195 This study is the first demonstration for association of the CNTNAP4 gene and one of its intronic CNV polymorphisms with aging.
22661486 A quantitative analysis of central corneal thickness and a subsequent analysis of primary open-angle glaucoma (POAG), SNPs in two cell adhesion molecules, NTM and CNTNAP4, were identified and may increase POAG susceptibility in a subset of cases.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
18398821 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSVTGAVLKTLLLLSTQNWNRVEAGNSYDCDDPLVSALPQASFSSSSELSSSHGPGFARLNRRDGAGGW      1 - 70
SPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNWKQYRQEDSIWGFSGNANADS     71 - 140
VVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYRSEVVDLDGKSSLLYRFDQKSLSPIKDIISL    141 - 210
KFKTMQSDGILLHREGPNGDHITLQLRRARLFLLINSGEAKLPSTSTLVNLTLGSLLDDQHWHSVLIQRL    211 - 280
GKQVNFTVDEHRHHFHARGEFNLMNLDYEISFGGIPAPGKSVSFPHRNFHGCLENLYYNGVDIIDLAKQQ    281 - 350
KPQIIAMGNVSFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISGGIL    351 - 420
LFLSDGKLKSNLYQPGKLPSDITAGVELNDGQWHSVSLSAKKNHLSVAVDGQMASAAPLLGPEQIYSGGT    421 - 490
YYFGGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLGNFSDLQIDSCGISDRCLPNYCEH    491 - 560
GGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAYKHRGNTSGFYYIDSDGSGPLEPFLLYCNMTETA    561 - 630
WTIIQHNGSDLTRVRNTNPENPYAGFFEYVASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSW    631 - 700
WVGRTNETQTYWGGSSPDLQKCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTG    701 - 770
RLHSEAAYKLGPLLCQGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIADFI    771 - 840
RIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRVERNMKEASLQVDQLTPKTQPAPADGHVLL    841 - 910
QLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPGCRGHCSSYGKLCRNGGKCRERPI    911 - 980
GFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQENYLLSKNSSSHAASFHGDMKLSREMIKFSFRTTR    981 - 1050
TPSLLLFVSSFYKEYLSVIIAKNGSLQIRYKLNKYQEPDVVNFDFKNMADGQLHHIMINREEGVVFIEID   1051 - 1120
DNRRRQVHLSSGTEFSAVKSLVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDP   1121 - 1190
VTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCITAI   1191 - 1260
AVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF                         1261 - 1308
//

Text Mined References (20)

PMID Year Title
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24223195 2013 A common copy number variation (CNV) polymorphism in the CNTNAP4 gene: association with aging in females.
23395182 2013 The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22661486 2012 Genome-wide analysis of central corneal thickness in primary open-angle glaucoma cases in the NEIGHBOR and GLAUGEN consortia.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20361982 2010 The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
More...