Property Summary

NCBI Gene PubMed Count 9
Grant Count 9
R01 Count 5
Funding $827,082.66
PubMed Score 201.17
PubTator Score 31.20

Knowledge Summary

Patent (11,307)

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.100 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -1.600 0.002
primitive neuroectodermal tumor -1.100 0.016
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.300 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGKEPLTLKSIQVAVEELYPNKARALTLAQHSRAPSPRLRSRLFSKALKGDHRCGETETPKSCSEVAGCK      1 - 70
AAMRHQGKIPEELSLDDRARTQKKWGRGKWEPEPSSKPPREATLEERHARGEKHLGVEIEKTSGEIIRCE     71 - 140
KCKRERELQQSLERERLSLGTSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNP    141 - 210
TQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREH    211 - 280
QAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAA    281 - 350
NVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILIIQSLSHPNIVKLHEV    351 - 420
YETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHRDLKPENLLVQRNED    421 - 490
KSTTLKLADFGLAKHVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQ    491 - 560
DELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWIETAGKTNTVKRQKQVSP    561 - 630
SSEGHFRSQHKRVVEQVS                                                        631 - 648
//

Text Mined References (10)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
17914117 2007 A diagnostic marker set for invasion, proliferation, and aggressiveness of prolactin pituitary tumors.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16869982 2006 The evolving doublecortin (DCX) superfamily.
16684769 2006 Molecular identification and characterization of a family of kinases with homology to Ca2+/calmodulin-dependent protein kinases I/IV.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11181995 2001 The sequence of the human genome.