Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.53
PubTator Score 1.00

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.145 3.2e-02
astrocytic glioma 1.500 4.2e-02
atypical teratoid / rhabdoid tumor 1.200 9.8e-03
Breast cancer 1.300 1.6e-04
cutaneous lupus erythematosus -1.500 1.1e-03
ependymoma 1.100 1.9e-02
group 3 medulloblastoma -1.300 5.0e-04
lung carcinoma 1.100 8.2e-19
osteosarcoma 1.004 2.1e-02
ovarian cancer 1.300 1.6e-08
psoriasis -1.900 3.8e-40


Accession Q9C091 A4QN17 Q9H8F1
Symbols RHDA3


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

ELEDEWQFRLRDEFQTANSSDDKPLYFLTGRHV                                        1891 - 1923

Text Mined References (7)

PMID Year Title