Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.26
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Eating disorder 24 3.732 1.9

Expression

Synonym

Accession Q9C086
Symbols IES2
PAPA1
hIes2
PAPA-1
ZNHIT4
HMGA1L4
HMGIYL4
PAP-1BP

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
25143393 pathway-guided genome-wide meta-analysis and mutational analysis identified INO80B gene is a susceptibility gene for pre-eclampsia.
22082156 Knockdown of INO80 complex subunit B (INO80B; ZNHIT4) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLK      1 - 70
LKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGG     71 - 140
LGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTE    141 - 210
EMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQ    211 - 280
GSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPG    281 - 350
SPLLAT                                                                    351 - 356
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25143393 2015 Susceptibility allele-specific loss of miR-1324-mediated silencing of the INO80B chromatin-assembly complex gene in pre-eclampsia.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
19095771 2009 PAPA-1 Is a nuclear binding partner of IGFBP-2 and modulates its growth-promoting actions.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15556297 2004 A novel nucleolar protein, PAPA-1, induces growth arrest as a result of cell cycle arrest at the G1 phase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...