Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.13
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Eating disorder 26 3.993 2.0

Expression

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLK      1 - 70
LKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGG     71 - 140
LGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTE    141 - 210
EMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQ    211 - 280
GSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPG    281 - 350
SPLLAT                                                                    351 - 356
//

Text Mined References (13)

PMID Year Title