Property Summary

NCBI Gene PubMed Count 19
PubMed Score 34.40
PubTator Score 33.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (11)

Disease log2 FC p
Atopic dermatitis -1.700 3.3e-05
Breast cancer -3.100 2.7e-08
colon cancer 2.700 2.6e-02
Endometriosis -1.334 2.2e-02
intraductal papillary-mucinous neoplasm ... 2.100 2.9e-02
lung cancer 2.000 1.2e-04
nasopharyngeal carcinoma -2.600 3.5e-06
osteosarcoma -3.154 5.0e-04
ovarian cancer 2.300 3.1e-04
pancreatic cancer 1.900 3.8e-03
spina bifida -2.693 3.0e-02

Gene RIF (9)

AA Sequence

MNSGHSFSQTPSASFHGAGGGWGRPRSFPRAPTVHGGAGGARISLSFTTRSCPPPGGSWGSGRSSPLLGG      1 - 70
NGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYSQYEENITHLQEQIVDGKMTN     71 - 140
AQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRRTLDNLTIVTTDLEQEVEGMRKELILMKKHH    141 - 210
EQEMEKHHVPSDFNVNVKVDTGPREDLIKVLEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATV    211 - 280
QSRQGDIHELKRTFQALEIDLQTQYSTKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQ    281 - 350
NNEYQVLLGIKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGRLVLCQVNEIQK    351 - 420
HA                                                                        421 - 422
//

Text Mined References (21)

PMID Year Title