Property Summary

NCBI Gene PubMed Count 19
PubMed Score 33.16
PubTator Score 33.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 2.73747534976433E-8
nasopharyngeal carcinoma 1056 3.50521864329084E-6
Atopic dermatitis 944 3.33354490416618E-5
lung cancer 4473 1.19721795560949E-4
ovarian cancer 8492 3.14559999640172E-4
osteosarcoma 7933 4.99633103106267E-4
pancreatic cancer 2300 0.00382343093999174
Endometriosis 535 0.0216696063915761
colon cancer 1475 0.0258597544833741
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0290575767899637
spina bifida 1064 0.0302889954480088

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -3.154 0.000
Atopic dermatitis -1.700 0.000
intraductal papillary-mucinous neoplasm ... 2.100 0.029
colon cancer 2.700 0.026
lung cancer 2.000 0.000
pancreatic cancer 1.900 0.004
nasopharyngeal carcinoma -2.600 0.000
Endometriosis -1.334 0.022
spina bifida -2.693 0.030
Breast cancer -3.100 0.000
ovarian cancer 2.300 0.000

Synonym

Accession Q9C075 A8K084 B7Z7J2 I3L3Q6 Q9NUR6
Symbols K23
CK23
HAIK1

Gene

  Ortholog (10)

Gene RIF (9)

PMID Text
24039993 Data show that Keratin23 (KRT23) knockdown affected molecules of the cell cycle and DNA replication, recombination and repair.
23682078 Increased expression of KRT23 is associated with colorectal cancer.
21492476 Data suggest a regulatory circuitry involving Smad4 dependent up-regulation of KRT23 (directly or indirectly) which in turn modulates the interaction between KRT23 and 14-3-3epsilon leading to a cytoplasmic sequestration of 14-3-3epsilon.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19383294 Keratin23 expression is a novel and important difference between microsatellite-stable and microsatellite-instable colon cancers.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
15081423 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSGHSFSQTPSASFHGAGGGWGRPRSFPRAPTVHGGAGGARISLSFTTRSCPPPGGSWGSGRSSPLLGG      1 - 70
NGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYSQYEENITHLQEQIVDGKMTN     71 - 140
AQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRRTLDNLTIVTTDLEQEVEGMRKELILMKKHH    141 - 210
EQEMEKHHVPSDFNVNVKVDTGPREDLIKVLEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATV    211 - 280
QSRQGDIHELKRTFQALEIDLQTQYSTKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQ    281 - 350
NNEYQVLLGIKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGRLVLCQVNEIQK    351 - 420
HA                                                                        421 - 422
//

Text Mined References (21)

PMID Year Title
24039993 2013 Keratin23 (KRT23) knockdown decreases proliferation and affects the DNA damage response of colon cancer cells.
23682078 2013 Identification of putative immunologic targets for colon cancer prevention based on conserved gene upregulation from preinvasive to malignant lesions.
21492476 2011 Keratin 23, a novel DPC4/Smad4 target gene which binds 14-3-3?.
21269460 2011 Initial characterization of the human central proteome.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19383294 2007 Phosphoprotein Keratin 23 accumulates in MSS but not MSI colon cancers in vivo and impacts viability and proliferation in vitro.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
More...