Property Summary

NCBI Gene PubMed Count 4
PubMed Score 319.01
PubTator Score 13.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

 GO Component (1)

Gene RIF (2)

AA Sequence

MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGA      1 - 70
AGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGG     71 - 140
VLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVE    141 - 210
MASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL       211 - 277
//

Text Mined References (6)

PMID Year Title