Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.70
PubTator Score 3.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.46288090914432E-7
ovarian cancer 8492 3.48261722155334E-5
Rheumatoid Arthritis 1171 0.00296718495793805
adult high grade glioma 2148 0.00347726466492234
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00564460796818883
oligodendroglioma 2849 0.00754019838262355
astrocytic glioma 2241 0.0079764869972953
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0130814084059559
group 3 medulloblastoma 2254 0.044204951071121
Disease Target Count Z-score Confidence
Dermatophytosis 12 3.388 1.7

Expression

Synonym

Accession Q9C037 A4D298 Q75MK1 Q96F06 Q9C036
Symbols RNF87

Gene

  Ortholog (3)

Species Source
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Pig OMA Inparanoid

Gene RIF (2)

PMID Text
24755855 TRIM4 is an important regulator of the virus-induced interferon induction pathways by mediating RIG-I for K63-linked ubiquitination.
19658100 ZNF198-FGFR1 is associated with phosphorylation of several proteins including SSBP2, ABL, FLJ14235, CALM and TRIM4 proteins.

AA Sequence

MEAEDIQEELTCPICLDYFQDPVSIECGHNFCRGCLHRNWAPGGGPFPCPECRHPSAPAALRPNWALARL      1 - 70
TEKTQRRRLGPVPPGLCGRHWEPLRLFCEDDQRPVCLVCRESQEHQTHAMAPIDEAFESYRTGNFDIHVD     71 - 140
EWKRRLIRLLLYHFKQEEKLLKSQRNLVAKMKKVMHLQDVEVKNATQWKDKIKSQRMRISTEFSKLHNFL    141 - 210
VEEEDLFLQRLNKEEEETKKKLNENTLKLNQTIASLKKLILEVGEKSQAPTLELLQNPKEVLTRSEIQDV    211 - 280
NYSLEAVKVKTVCQIPLMKEMLKRFQVAVNLAEDTAHPKLVFSQEGRYVKNTASASSWPVFSSAWNYFAG    281 - 350
WRNPQKTAFVERFQHLPCVLGKNVFTSGKHYWEVESRDSLEVAVGVCREDVMGITDRSKMSPDVGIWAIY    351 - 420
WSAAGYWPLIGFPGTPTQQEPALHRVGVYLDRGTGNVSFYSAVDGVHLHTFSCSSVSRLRPFFWLSPLAS    421 - 490
LVIPPVTDRK                                                                491 - 500
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24755855 2014 TRIM4 modulates type I interferon induction and cellular antiviral response by targeting RIG-I for K63-linked ubiquitination.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
19658100 2009 Phosphorylation of the SSBP2 and ABL proteins by the ZNF198-FGFR1 fusion kinase seen in atypical myeloproliferative disorders as revealed by phosphopeptide-specific MS.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17156811 2007 Unique features of TRIM5alpha among closely related human TRIM family members.
16314882 Sequence diversity and haplotype structure at the human CYP3A cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...