Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.19
PubTator Score 3.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.200 3.5e-03
astrocytic glioma 1.100 8.0e-03
ependymoma 1.100 2.0e-08
group 3 medulloblastoma 1.100 4.4e-02
intraductal papillary-mucinous adenoma (... 1.100 5.6e-03
intraductal papillary-mucinous carcinoma... 1.300 1.3e-02
oligodendroglioma 1.500 7.5e-03
ovarian cancer -2.300 3.5e-05
Rheumatoid arthritis 1.400 3.0e-03

Gene RIF (2)

AA Sequence

MEAEDIQEELTCPICLDYFQDPVSIECGHNFCRGCLHRNWAPGGGPFPCPECRHPSAPAALRPNWALARL      1 - 70
TEKTQRRRLGPVPPGLCGRHWEPLRLFCEDDQRPVCLVCRESQEHQTHAMAPIDEAFESYRTGNFDIHVD     71 - 140
EWKRRLIRLLLYHFKQEEKLLKSQRNLVAKMKKVMHLQDVEVKNATQWKDKIKSQRMRISTEFSKLHNFL    141 - 210
VEEEDLFLQRLNKEEEETKKKLNENTLKLNQTIASLKKLILEVGEKSQAPTLELLQNPKEVLTRSEIQDV    211 - 280
NYSLEAVKVKTVCQIPLMKEMLKRFQVAVNLAEDTAHPKLVFSQEGRYVKNTASASSWPVFSSAWNYFAG    281 - 350
WRNPQKTAFVERFQHLPCVLGKNVFTSGKHYWEVESRDSLEVAVGVCREDVMGITDRSKMSPDVGIWAIY    351 - 420
WSAAGYWPLIGFPGTPTQQEPALHRVGVYLDRGTGNVSFYSAVDGVHLHTFSCSSVSRLRPFFWLSPLAS    421 - 490
LVIPPVTDRK                                                                491 - 500
//

Text Mined References (14)

PMID Year Title