Property Summary

NCBI Gene PubMed Count 128
PubMed Score 204.78
PubTator Score 344.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.278 6.1e-03
adult high grade glioma 1.600 3.1e-03
Astrocytoma, Pilocytic 2.100 4.6e-08
atypical teratoid / rhabdoid tumor 1.600 6.2e-03
cutaneous lupus erythematosus 1.800 2.6e-04
ependymoma 1.800 7.2e-07
glioblastoma 1.900 2.3e-06
lung cancer -1.700 2.1e-03
lung carcinoma -1.700 1.5e-24
osteosarcoma -2.133 2.8e-06
ovarian cancer -1.400 4.8e-04
primitive neuroectodermal tumor 1.300 1.7e-02
subependymal giant cell astrocytoma 1.506 3.4e-03
ulcerative colitis 1.100 5.6e-06

Protein-protein Interaction (3)

Gene RIF (207)

AA Sequence

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPN      1 - 70
RHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQV     71 - 140
KLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDI    141 - 210
LKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPD    211 - 280
LKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILG    281 - 350
SQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT    351 - 420
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCS    421 - 490
PSS                                                                       491 - 493
//

Text Mined References (137)

PMID Year Title