Property Summary

NCBI Gene PubMed Count 124
Grant Count 132
R01 Count 52
Funding $23,749,674.27
PubMed Score 201.40
PubTator Score 344.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 0.000
glioblastoma 1.900 0.000
osteosarcoma -2.133 0.000
ependymoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.600 0.006
primitive neuroectodermal tumor 1.300 0.017
lung cancer -1.700 0.002
active Crohn's disease 1.278 0.006
pediatric high grade glioma 1.800 0.000
pilocytic astrocytoma 2.100 0.000
subependymal giant cell astrocytoma 1.506 0.003
lung carcinoma -1.700 0.000
ulcerative colitis 1.100 0.000
ovarian cancer -1.400 0.000

Gene

PDB

2ECV   2YRG  

Gene RIF (306)

PMID Text
26764007 Collectively, these results are consistent with observations that the turnover of TRIM5alpha proteins is sensitive to autophagy inhibition; however, the data presented here do not support observations that the inhibition of autophagy abrogates retroviral restriction by TRIM5 proteins.
26398573 This meta-analysis indicates that TRIM5alpha H43Y polymorphism is associated with a decreased risk of HIV-1 infection in the homozygote comparison and recessive model.
26212332 higher-order oligomerization of TRIM5alpha, which is promoted by the interaction with the retroviral capsid, enhances the E3 Ub ligase activity of TRIM5alpha and contributes to its antiretroviral function.
26101372 TRIM5alpha requires Ube2W to anchor Lys63-linked ubiquitin chains and restrict reverse transcription.
26076730 These results support the relevance of R332G-R335G and other mutants of TRIM5alphahu as candidate effectors for HIV-1 gene therapy.
26076730 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
25924204 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
25731773 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
25412268 co-immunoprecipitation experiments demonstrate that IE1CORE binds via the coiled-coil domain to PML and also interacts with TRIM5alpha
25195168 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
More...

AA Sequence

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPN      1 - 70
RHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQV     71 - 140
KLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDI    141 - 210
LKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPD    211 - 280
LKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILG    281 - 350
SQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT    351 - 420
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCS    421 - 490
PSS                                                                       491 - 493
//

Text Mined References (133)

PMID Year Title
26764007 2016 TRIM5? Degradation via Autophagy Is Not Required for Retroviral Restriction.
26398573 2015 TRIM5? H43Y Polymorphism and Susceptibility to HIV-1 Infection: A Meta-Analysis.
26212332 2015 RING Dimerization Links Higher-Order Assembly of TRIM5? to Synthesis of K63-Linked Polyubiquitin.
26101372 2015 TRIM5? requires Ube2W to anchor Lys63-linked ubiquitin chains and restrict reverse transcription.
26076730 2015 Preclinical Assessment of Mutant Human TRIM5? as an Anti-HIV-1 Transgene.
25412268 2014 Crystal structure of cytomegalovirus IE1 protein reveals targeting of TRIM family member PML via coiled-coil interactions.
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24662946 2014 Stabilized human TRIM5? protects human T cells from HIV-1 infection.
24613845 2014 TRIMe7-CypA, an alternative splicing isoform of TRIMCyp in rhesus macaque, negatively modulates TRIM5? activity.
More...