Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.75
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.700 1.2e-04
aldosterone-producing adenoma -1.139 1.3e-02
Astrocytoma, Pilocytic 1.600 7.3e-05
Breast cancer 2.400 2.9e-02
cystic fibrosis 1.175 1.3e-04
glioblastoma 1.700 2.6e-05
interstitial cystitis -1.800 8.7e-04
intraductal papillary-mucinous adenoma (... -1.200 1.4e-04
intraductal papillary-mucinous carcinoma... -1.200 9.5e-03
invasive ductal carcinoma -1.100 1.8e-02
osteosarcoma -2.623 6.8e-05
ovarian cancer -2.700 8.1e-11

Gene RIF (8)

AA Sequence

MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQTSYQPGNLRP      1 - 70
NRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQEY     71 - 140
QEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPERCRIQTEFNQLRNILDRVEQRELKKLEQEEK    141 - 210
KGLRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRA    211 - 280
PDLKRMLRVCRELTDVQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHF    281 - 350
SSGKHYWEVDVAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP    351 - 420
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIPMTLRRPSS      421 - 488
//

Text Mined References (17)

PMID Year Title