Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $7,832.43
PubMed Score 0.75
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9C030 A8K2A7 B4DDQ5 Q86WZ8 Q9HCR1
Symbols RNF89

Gene

 Grant Application (1)

Gene RIF (7)

PMID Text
24882218 TRIM6 and the E2-ubiquitin conjugase UbE2K cooperated in the synthesis of unanchored K48-linked polyubiquitin chains, which activated IKKepsilon for subsequent STAT1 phosphorylation.
24314652 Human TRIM6 binds in vitro assembled HIV-1 CA-NC complexes
24314652 Human TRIM6 binds in vitro assembled HIV-1 CA-NC complexes
17156811 Human TRIM6 binds in vitro assembled HIV-1 CA-NC complexes
16828831 Human TRIM6 binds in vitro assembled HIV-1 CA-NC complexes
16775307 heterologous RING, B-box 2, and CC domains from related TRIM proteins can functionally substitute for TRIM5alpha(rh) domains.
16775307 Human TRIM6 binds in vitro assembled HIV-1 CA-NC complexes

AA Sequence

MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQTSYQPGNLRP      1 - 70
NRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQEY     71 - 140
QEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPERCRIQTEFNQLRNILDRVEQRELKKLEQEEK    141 - 210
KGLRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRA    211 - 280
PDLKRMLRVCRELTDVQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHF    281 - 350
SSGKHYWEVDVAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP    351 - 420
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIPMTLRRPSS      421 - 488
//

Text Mined References (15)

PMID Year Title
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21680743 2011 Determinants of the higher order association of the restriction factor TRIM5alpha and other tripartite motif (TRIM) proteins.
18159944 2007 Discordant evolution of the adjacent antiretroviral genes TRIM22 and TRIM5 in mammals.
17156811 2007 Unique features of TRIM5alpha among closely related human TRIM family members.
16775307 2006 Functional replacement of the RING, B-box 2, and coiled-coil domains of tripartite motif 5alpha (TRIM5alpha) by heterologous TRIM domains.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16498413 2006 Structural and functional insights into the B30.2/SPRY domain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...